![Western Blot: MOS Antibody [H00004342-D01P] - Analysis of MOS expression in human pancreas.](http://images.novusbio.com/fullsize/MOS-Antibody-Western-Blot-H00004342-D01P-img0003.jpg "Western Blot: MOS Antibody [H00004342-D01P] - Analysis of MOS expression in human pancreas.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | MOS (NP_005363.1, 1 a.a. - 346 a.a.) full-length human protein. MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLKYSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG |
| Specificity | Reacts with v-mos Moloney murine sarcoma viral oncogene homolog. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MOS |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MOS Antibody (H00004342-D01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MOS |
| Entrez |
|
| Uniprot |
|
![Western Blot: MOS Antibody [H00004342-D01P] - Analysis of MOS expression in transfected 293T cell line by MOS polyclonal antibody.Lane 1: MOS transfected lysate(37.80 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/MOS-Antibody-Western-Blot-H00004342-D01P-img0004.jpg "Western Blot: MOS Antibody [H00004342-D01P] - Analysis of MOS expression in transfected 293T cell line by MOS polyclonal antibody.Lane 1: MOS transfected lysate(37.80 KDa).Lane 2: Non-transfected lysate.")
![Knockout Validated Mesothelin Antibody (420411) [Unconjugated]](https://images.novusbio.com/images2/Mesothelin_MAB32652_Knockout_Validated_23078.jpg)
![ELISA Mesothelin Antibody (420411) [Unconjugated]](https://images.novusbio.com/images2/Mesothelin_MAB32652_ELISA_23423.jpg)
![Flow Cytometry Mesothelin Antibody (420411) [Unconjugated]](https://images.novusbio.com/images2/Mesothelin_MAB32652_Flow_Cytometry_8401.jpg)
![Western Blot Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/Raf-1_MAB4540_Western_Blot_9426.jpg)
![Immunohistochemistry Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/Raf-1_MAB4540_Immunohistochemistry_9891.jpg)
![Simple Western Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/mab4540_human-mouse-rat-raf-1-mab-clone-563002-simple-western-158202212919.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Western Blot c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/c-Abl_AF5414_Western_Blot_5714.jpg)
![Simple Western c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/cAbl_AF5414_Simple_Western_17046.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")