Home » MNK1 » MNK1 Proteins » MNK1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MNK1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MNK1 Recombinant Protein Antigen (NBP2-56054PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MNK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MNK1.

Source: E. coli

Amino Acid Sequence: EKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MKNK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56054.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MNK1 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • MAP kinase interacting kinase 1
  • MAP kinase interacting serine/threonine kinase 1
  • MAP kinase signal-integrating kinase 1
  • MAP kinase-interacting serine/threonine-protein kinase 1
  • MKNK1
  • MNK1
  • MNK1MAP kinase-interacting serine/threonine kinase 1

Background

MNK1 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot eIF4E [p Ser209] Antibody
Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody
Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
MNK2 Antibody
(2A10)
H00002872-M07
Western Blot MNK2 Antibody (2A10)
ELISA MNK2 Antibody (2A10)
Proximity Ligation Assay MNK2 Antibody (2A10)
Species: Hu, Mu, Rt
Applications: ELISA, PLA, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
eIF4G1 Antibody
NB100-268
Western Blot eIF4G1 Antibody
Immunoprecipitation eIF4G1 Antibody
(26 Publications)
Species: Hu, Po
Applications: IP, WB
ATP7A Antibody
(S60-4)
NBP2-59376
Western Blot ATP7A Antibody (S60-4)
Western Blot ATP7A Antibody (S60-4)
Immunocytochemistry/ Immunofluorescence ATP7A Antibody (S60-4)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western p38 alpha Antibody [Unconjugated]
Western Blot p38 alpha Antibody [Unconjugated]
Immunohistochemistry p38 alpha Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
4EBP1 Antibody
NB200-157
Knockout Validated 4EBP1 Antibody
Western Blot 4EBP1 Antibody
Western Blot 4EBP1 Antibody
(45 Publications)
Species: Hu
Applications: IHC, IHC-P, KO, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin SGSM3 Antibody
Immunocytochemistry/ Immunofluorescence SGSM3 Antibody
Western Blot SGSM3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Crk Antibody
(3G11E8) - BSA Free
NBP2-37568
ELISA Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
GRAP2 Antibody
(OTI1G2)
NBP2-00764
Flow Cytometry GRAP2 Antibody (OTI1G2)
Flow Cytometry GRAP2 Antibody (OTI1G2)
Western Blot GRAP2 Antibody (OTI1G2)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AIMP2 Antibody
NBP1-81575
Immunohistochemistry-Paraffin AIMP2 Antibody
Immunohistochemistry-Paraffin AIMP2 Antibody
Immunohistochemistry-Paraffin AIMP2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
POLDIP2 Antibody
NBP1-68874
Western Blot POLDIP2 Antibody
Western Blot POLDIP2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
AHSA1 Antibody
(1A2-A8)
H00010598-M01
Western Blot AHSA1 Antibody (1A2-A8)
Sandwich ELISA AHSA1 Antibody (1A2-A8)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
eIF4A2 Antibody
NBP2-24529
Western Blot eIF4A2 Antibody
Immunohistochemistry-Paraffin eIF4A2 Antibody
Simple Western eIF4A2 Antibody
(1 Review)
(1 Publication)
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC, IHC-P, Simple Western, WB
Ribosomal Protein
S6/RPS6 [p Ser235, p ...
AF3918
Western Blot Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]
Simple Western Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]
Immunohistochemistry Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
p38 gamma/SAPK3
Antibody [Unconjugate
AF1347
Immunocytochemistry p38 gamma/SAPK3 Antibody [Unconjugated]
Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]
Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]
(8 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
MNK1 Recombinant
Protein Antigen
NBP2-56054PEP
MNK1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for MNK1 Recombinant Protein Antigen (NBP2-56054PEP) (0)

There are no publications for MNK1 Recombinant Protein Antigen (NBP2-56054PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MNK1 Recombinant Protein Antigen (NBP2-56054PEP) (0)

There are no reviews for MNK1 Recombinant Protein Antigen (NBP2-56054PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MNK1 Recombinant Protein Antigen (NBP2-56054PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MNK1 Products

Research Areas for MNK1 Recombinant Protein Antigen (NBP2-56054PEP)

Find related products by research area.

Blogs on MNK1

There are no specific blogs for MNK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
EphB2 Antibody [Unconjugated]
AF467

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MNK1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MKNK1