Recombinant Human Melatonin R1A/MT1/MTNR1A GST (N-Term) Protein Summary
Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 296-350 of Human Melatonin R1A/MT1/MTNR1A Source: Wheat Germ (in vitro) Amino Acid Sequence: GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source |
Wheat germ |
Protein/Peptide Type |
Recombinant Protein |
Gene |
MTNR1A |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
Theoretical MW |
31.79 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Melatonin R1A/MT1/MTNR1A GST (N-Term) Protein
Background
MTNR1A - melatonin receptor 1A
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Bv, Ca, Hu, Mu, Po, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, KO, WB
Species: Hu
Applications: WB, ELISA, MA, AP
Publications for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01)(1)
Showing Publication 1 -
1 of 1.
Reviews for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01) (0)
There are no reviews for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01). (Showing 1 - 2 of 2 FAQ).
-
I saw that you have the antibodies for the both receptors of melatonin but not listed with FACS application. I need more information about what is better for my assay.
- At this time, none of our melatonin receptor antibodies have been tested and validated in Flow. Should you choose to purchase and test one of them, you would qualify for the Innovator's Rewards program. You should take a look at each individual antibody, the clonality, conjugates, immunogen region and all relevant data in order to decide which product would be most suitable for your needs.
-
Do you have MTNR1A polyclonal antibody ?
- Here are our MTNR1A antibodies that are polyclonal
Additional Melatonin R1A/MT1/MTNR1A Products
Research Areas for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01)
Find related products by research area.
|
Blogs on Melatonin R1A/MT1/MTNR1A