Home » MEKK3 » MEKK3 Proteins » MEKK3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MEKK3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MEKK3 Protein (NBP2-34004PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MEKK3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAP3K3.

Source: E. coli

Amino Acid Sequence: EQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQKKHNSSSSALLNSPTVTTSSCAGASEKKKFLSDVRIKFEHNGE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAP3K3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34004.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MEKK3 Recombinant Protein Antigen

  • EC 2.7.11.25
  • MAP/ERK kinase kinase 3
  • MAP3K3
  • MAPK/ERK kinase kinase 3
  • MAPKKK3
  • MAPKKK3MEKK 3
  • MEK kinase 3
  • MEKK3
  • mitogen-activated protein kinase kinase kinase 3

Background

MEKK3 is a Ser/Thr protein kinase belonging to the MAP/ERK kinase kinase family (1). Closely related to MEKK2, MEKK3 is expressed in a multitude of tissues. MEKK3 directly regulates SAPKs and ERKs pathway via SEK and MEK1, respectively but not the p38 pathway (2) and is also involved in the NF-kB pathway (3). MEKK3 as well as MEKK2 bind, phosphorylate and activate MEK5 through their PB1 domain (4). hKSR-2 (human kinase suppressor of ras-2) has been shown to regulate the activity of MEKK3 (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
MEKK2 Antibody
(722728)
MAB7128
Western Blot MEKK2 Antibody (722728)
Immunocytochemistry MEKK2 Antibody (722728)
Species: Hu, Mu, Rt
Applications: ICC, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
MEK5 Antibody
NBP1-89654
Western Blot MEK5 Antibody
Immunohistochemistry-Paraffin MEK5 Antibody
Immunohistochemistry-Paraffin MEK5 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
ERK5/BMK1 Antibody
[Unconjugated]
AF2848
Western Blot ERK5/BMK1 Antibody [Unconjugated]
Immunocytochemistry ERK5/BMK1 Antibody [Unconjugated]
(4 Publications)
Species: Hu, Mu
Applications: ICC, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western p38 alpha Antibody [Unconjugated]
Western Blot p38 alpha Antibody [Unconjugated]
Immunohistochemistry p38 alpha Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
MEKK1 Antibody -
Azide and BSA Free
NBP3-02962
Immunocytochemistry/ Immunofluorescence MEKK1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin MEKK1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin MEKK1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Crk Antibody
(3G11E8) - BSA Free
NBP2-37568
ELISA Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
GRAP2 Antibody
(OTI1G2)
NBP2-00764
Flow Cytometry GRAP2 Antibody (OTI1G2)
Flow Cytometry GRAP2 Antibody (OTI1G2)
Western Blot GRAP2 Antibody (OTI1G2)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AIMP2 Antibody
NBP1-81575
Immunohistochemistry-Paraffin AIMP2 Antibody
Immunohistochemistry-Paraffin AIMP2 Antibody
Immunohistochemistry-Paraffin AIMP2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
POLDIP2 Antibody
NBP1-68874
Western Blot POLDIP2 Antibody
Western Blot POLDIP2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
AHSA1 Antibody
(1A2-A8)
H00010598-M01
Western Blot AHSA1 Antibody (1A2-A8)
Sandwich ELISA AHSA1 Antibody (1A2-A8)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
WNK2 Antibody
NBP2-33875
Immunocytochemistry/ Immunofluorescence WNK2 Antibody
Immunohistochemistry-Paraffin WNK2 Antibody
Immunohistochemistry-Paraffin WNK2 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TAK1 Antibody
NB100-56363
Immunohistochemistry-Paraffin TAK1 Antibody
Immunocytochemistry/ Immunofluorescence TAK1 Antibody
Immunocytochemistry/ Immunofluorescence TAK1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MEKK3 Recombinant
Protein Antigen
NBP2-34004PEP
MEKK3 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for MEKK3 Protein (NBP2-34004PEP) (0)

There are no publications for MEKK3 Protein (NBP2-34004PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEKK3 Protein (NBP2-34004PEP) (0)

There are no reviews for MEKK3 Protein (NBP2-34004PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MEKK3 Protein (NBP2-34004PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MEKK3 Products

Research Areas for MEKK3 Protein (NBP2-34004PEP)

Find related products by research area.

Blogs on MEKK3

There are no specific blogs for MEKK3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MEKK3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MAP3K3