Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, ICC/IF |
Clone | 1D10 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen | ARMET (NP_006001.2, 116 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL |
Specificity | Reacts with arginine-rich, mutated in early stage tumors. |
Isotype | IgG1 Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | MANF |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | This antibody is reactive against recombinant protein in WB and ELISA. |
|
Reviewed Applications |
|
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | Protein A purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
reviewed by:
Verified Customer |
ICC | Human | 01/03/2022 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for MANF Antibody (H00007873-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.