![Immunohistochemistry-Paraffin: MAATS1 Antibody [NBP3-17106] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/MAATS1-Antibody-Immunohistochemistry-Paraffin-NBP3-17106-img0005.jpg "Immunohistochemistry-Paraffin: MAATS1 Antibody [NBP3-17106] - Staining of human liver shows low expression as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DFLSKELVRLQEERRIHAFVMLAERQRRVREAEESGRRQVEKQRLREEDEIFKEVVKVHHSTISSYLEDIILNTEANT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MAATS1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot TGF-beta RII Antibody [Unconjugated]](https://images.novusbio.com/images2/TGFbeta_RII_AF241NA_Western_Blot_21284.jpg)
![Neutralization TGF-beta RII Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RII_AF-241-NA_Block_Neutralize_8662.jpg)
![Immunohistochemistry TGF-beta RII Antibody [Unconjugated]](https://images.novusbio.com/images2/TGF-beta_RII_AF-241-NA_Immunohistochemistry_9941.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAATS1 |
![Immunohistochemistry-Paraffin: MAATS1 Antibody [NBP3-17106] - Staining of human fallopian tube shows high expression.](http://images.novusbio.com/fullsize/MAATS1-Antibody-Immunohistochemistry-Paraffin-NBP3-17106-img0001.jpg "Immunohistochemistry-Paraffin: MAATS1 Antibody [NBP3-17106] - Staining of human fallopian tube shows high expression.")
![Immunohistochemistry-Paraffin: MAATS1 Antibody [NBP3-17106] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/MAATS1-Antibody-Immunohistochemistry-Paraffin-NBP3-17106-img0002.jpg "Immunohistochemistry-Paraffin: MAATS1 Antibody [NBP3-17106] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: MAATS1 Antibody [NBP3-17106] - Analysis in human fallopian tube and liver tissues using Anti-MAATS1 antibody. Corresponding MAATS1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MAATS1-Antibody-Immunohistochemistry-Paraffin-NBP3-17106-img0004.jpg "Immunohistochemistry-Paraffin: MAATS1 Antibody [NBP3-17106] - Analysis in human fallopian tube and liver tissues using Anti-MAATS1 antibody. Corresponding MAATS1 RNA-seq data are presented for the same tissues.")
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![Knockout Validated Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Knockout_Validated_22540.jpg)
![Immunocytochemistry Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Immunocytochemistry__Immunofluorescence_19067.jpg)
![Western Blot Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Western_Blot_13853.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")