![Western Blot: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Western blot analysis of extracts of various cell lines, using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/Lysyl-tRNA-synthetase-Antibody-2V2B6-Western-Blot-NBP3-16670-img0006.jpg "Western Blot: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Western blot analysis of extracts of various cell lines, using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 2V2B6 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 500-597 of human Lysyl tRNA synthetase (Q15046). TELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | KARS1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KARS1 |
![Immunocytochemistry/Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunofluorescence analysis of U-2 OS cells using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Lysyl-tRNA-synthetase-Antibody-2V2B6-Immunocytochemistry-Immunofluorescence-NBP3-16670-img0005.jpg "Immunocytochemistry/Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunofluorescence analysis of U-2 OS cells using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunohistochemistry of paraffin-embedded mouse spinal cord using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Lysyl-tRNA-synthetase-Antibody-2V2B6-Immunohistochemistry-Paraffin-NBP3-16670-img0002.jpg "Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunohistochemistry of paraffin-embedded mouse spinal cord using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunocytochemistry/Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunofluorescence analysis of C6 cells using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Lysyl-tRNA-synthetase-Antibody-2V2B6-Immunocytochemistry-Immunofluorescence-NBP3-16670-img0003.jpg "Immunocytochemistry/Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunofluorescence analysis of C6 cells using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunofluorescence analysis of NIH-3T3 cells using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Lysyl-tRNA-synthetase-Antibody-2V2B6-Immunocytochemistry-Immunofluorescence-NBP3-16670-img0004.jpg "Immunocytochemistry/Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunofluorescence analysis of NIH-3T3 cells using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunohistochemistry of paraffin-embedded rat testis using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Lysyl-tRNA-synthetase-Antibody-2V2B6-Immunohistochemistry-Paraffin-NBP3-16670-img0001.jpg "Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunohistochemistry of paraffin-embedded rat testis using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunocytochemistry/ Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunofluorescence analysis of NIH-3T3 cells using Lysyl tRNA synthetase Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16670_rabbit-lysyl-trna-synthetase-mab-2v2b6-52202511374151.jpg "Immunocytochemistry/ Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunofluorescence analysis of NIH-3T3 cells using Lysyl tRNA synthetase Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [Lysyl tRNA synthetase] - Immunofluorescence analysis of NIH-3T3 cells using Lysyl tRNA synthetase Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16670_rabbit-lysyl-trna-synthetase-mab-2v2b6-52202517333877.jpg "Immunocytochemistry/ Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [Lysyl tRNA synthetase] - Immunofluorescence analysis of NIH-3T3 cells using Lysyl tRNA synthetase Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Simple Western p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/16324.jpg)
![Western Blot p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Western_Blot_22371.jpg)
![Immunohistochemistry p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Immunohistochemistry_7087.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")