Home » Lyp/PTPN22 » Lyp Peptides and Proteins » Lyp/PTPN22 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Lyp/PTPN22 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Lyp/PTPN22 Protein (NBP1-81276PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Lyp/PTPN22 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTPN22.

Source: E. coli

Amino Acid Sequence: SLLNQESAVLATAPRIDDEIPPPLPVRTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSLEWGGTSEPKKFDDSVILRPSKSVKLRSPKSELHQDRSSPPPPLPERTLESFFLADEDCMQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTPN22
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81276.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Lyp/PTPN22 Recombinant Protein Antigen

  • EC 3.1.3.48
  • Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP
  • Lymphoid phosphatase
  • lymphoid-specific protein tyrosine phosphatase
  • Lyp
  • Lyp1
  • Lyp2
  • LyPTP
  • PEP
  • PEST-domain phosphatase
  • protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
  • protein tyrosine phosphatase, non-receptor type 8
  • PTPN22
  • PTPN8 (former)
  • PTPN8LYP1
  • tyrosine-protein phosphatase non-receptor type 22

Background

PTPN22 encodes a protein tyrosine phosphatase which is expressed primarily in lymphoid tissues. This enzyme associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Prolyl
Oligopeptidase/PREP A
NBP2-33950
Immunocytochemistry/ Immunofluorescence Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PCK2 Antibody
NBP2-33606
Immunocytochemistry/ Immunofluorescence PCK2 Antibody
Immunohistochemistry-Paraffin PCK2 Antibody
Immunohistochemistry-Paraffin PCK2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PTS Antibody
NBP1-32975
Western Blot PTS Antibody
Western Blot PTS Antibody
Immunocytochemistry/ Immunofluorescence PTS Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Recombinant Human
HLA DRB4 GST (N-Term) ...
H00003126-P01
Other Recombinant Human HLA DRB4 GST (N-Term) Protein
(1 Publication)
Species: Hu
Applications: ELISA, AP, PA, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
CD77 Synthase
Antibody
NBP1-62583
Western Blot CD77 Synthase Antibody
(2 Publications)
Species: Hu
Applications: WB
PCK1 Antibody (3E4)
H00005105-M01
Western Blot PCK1 Antibody (3E4)
Immunocytochemistry/ Immunofluorescence PCK1 Antibody (3E4)
Immunoprecipitation PCK1 Antibody (3E4)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
ZAK Antibody (3G5)
H00051776-M03
Western Blot ZAK Antibody (3G5)
Immunocytochemistry/ Immunofluorescence ZAK Antibody (3G5)
Immunohistochemistry-Paraffin ZAK Antibody (3G5)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
HLA DRB1 Antibody
(SPM288)
NBP2-45312
Immunohistochemistry-Paraffin HLA DRB1 Antibody (SPM288)
Flow Cytometry HLA DRB1 Antibody (SPM288)
Immunofluorescence HLA DRB1 Antibody (SPM288)
(2 Publications)
Species: Hu, Pm, Mu(-)
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HLA DRB5 Antibody
NBP2-14093
Immunohistochemistry-Paraffin HLA DRB5 Antibody
Western Blot HLA DRB5 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
HLA DRB3 Antibody
(Bra30)
NBP3-07168
HLA DRB3 Antibody (Bra30)
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Progranulin/PGRN
Antibody [Unconjugate ...
AF2557
Western Blot Progranulin/PGRN Antibody [Unconjugated]
Immunohistochemistry Progranulin/PGRN Antibody [Unconjugated]
Immunocytochemistry Progranulin/PGRN Antibody [Unconjugated]
(1 Review)
(53 Publications)
Species: Mu
Applications: ICC, IHC, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(370 Publications)
Species: Hu
Applications: BA
Neprilysin/CD10
Antibody [Unconjugate
AF1126
Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]
Western Blot Neprilysin/CD10 Antibody [Unconjugated]
Western Blot Neprilysin/CD10 Antibody [Unconjugated]
(22 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Pepsinogen
C/PGC/Progastricsin A
NBP1-91011
Western Blot Pepsinogen C/PGC/Progastricsin Antibody
Western Blot Pepsinogen C/PGC/Progastricsin Antibody
Immunohistochemistry-Paraffin Pepsinogen C/PGC/Progastricsin Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
Complement
Component C2 Antibody ...
AF1936
Complement Component C2 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IP, WB

Publications for Lyp/PTPN22 Protein (NBP1-81276PEP) (0)

There are no publications for Lyp/PTPN22 Protein (NBP1-81276PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lyp/PTPN22 Protein (NBP1-81276PEP) (0)

There are no reviews for Lyp/PTPN22 Protein (NBP1-81276PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Lyp/PTPN22 Protein (NBP1-81276PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lyp/PTPN22 Products

Research Areas for Lyp/PTPN22 Protein (NBP1-81276PEP)

Find related products by research area.

Blogs on Lyp/PTPN22

There are no specific blogs for Lyp/PTPN22, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010
Western blot shows lysates of mouse uterus tissue and J774A.1 mouse reticulum cell sarcoma macrophage cell line. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Mouse Progranulin/PGRN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2557) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Progranulin/PGRN at approximately 85-90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Progranulin/PGRN Antibody [Unconjugated]
AF2557

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Lyp/PTPN22 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PTPN22