![Immunohistochemistry-Paraffin: LRP-1B Antibody [NBP2-49582] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/LRP-1B-Antibody-Immunohistochemistry-Paraffin-NBP2-49582-img0004.jpg "Immunohistochemistry-Paraffin: LRP-1B Antibody [NBP2-49582] - Staining of human kidney shows no positivity in cells in tubules as expected.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GGPSAFKLPHTAPPIYLNSDLKGPLTAGPTNYSNPVYAKLYMDGQNCRNSLGSVDERKELLPKK |
| Predicted Species | Mouse (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LRP1B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for LRP-1B Antibody (NBP2-49582)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LRP1B |
![Immunohistochemistry-Paraffin: LRP-1B Antibody [NBP2-49582] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/LRP-1B-Antibody-Immunohistochemistry-Paraffin-NBP2-49582-img0001.jpg "Immunohistochemistry-Paraffin: LRP-1B Antibody [NBP2-49582] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: LRP-1B Antibody [NBP2-49582] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/LRP-1B-Antibody-Immunohistochemistry-Paraffin-NBP2-49582-img0002.jpg "Immunohistochemistry-Paraffin: LRP-1B Antibody [NBP2-49582] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: LRP-1B Antibody [NBP2-49582] - Staining of human cervix, uterine, shows no postivity in epithelial cells as expected.](http://images.novusbio.com/fullsize/LRP-1B-Antibody-Immunohistochemistry-Paraffin-NBP2-49582-img0003.jpg "Immunohistochemistry-Paraffin: LRP-1B Antibody [NBP2-49582] - Staining of human cervix, uterine, shows no postivity in epithelial cells as expected.")
![Immunohistochemistry LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDL_R_AF2255_Immunohistochemistry_7149.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDLR_AF2255_Western_Blot_23731.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images/af2255_mouse-ldl-r-affinity-purified-polyclonal-ab-4120241049445.jpg)
![Immunohistochemistry LRP-4 Antibody (741704) [Unconjugated]](https://images.novusbio.com/images2/LRP-4_MAB5948_Immunohistochemistry_12067.jpg)
![Western Blot LRP-4 Antibody (741704) [Unconjugated]](https://images.novusbio.com/images2/LRP-4_MAB5948_Western_Blot_12220.jpg)
![Flow Cytometry LRP-4 Antibody (741704) [Unconjugated]](https://images.novusbio.com/images2/LRP4_MAB5948_Flow_Cytometry_23003.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry VLDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/VLDL_R_AF2258_Immunohistochemistry_22497.jpg)
![Immunohistochemistry VLDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/VLDL_R_AF2258_Immunohistochemistry_9765.jpg)
![N/A uPAR [HRP]](https://images.novusbio.com/images2/DATA_uPAR_DUP00_ELISA_866.jpg)
![N/A uPAR [HRP]](https://images.novusbio.com/images2/uPAR_DUP00_ELISA_203.jpg)
![Enzyme Activity u-Plasminogen Activator/Urokinase [Unconjugated]](https://images.novusbio.com/images2/uPlasminogen_Activator_1310SE_1837.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")