![Immunocytochemistry/Immunofluorescence: LPP Antibody (8M2R8) [NBP3-15690] - Immunofluorescence analysis of NIH/3T3 cells using LPP Rabbit mAb (NBP3-15690) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/LPP-Antibody-8M2R8-Immunocytochemistry-Immunofluorescence-NBP3-15690-img0002.jpg "Immunocytochemistry/Immunofluorescence: LPP Antibody (8M2R8) [NBP3-15690] - Immunofluorescence analysis of NIH/3T3 cells using LPP Rabbit mAb (NBP3-15690) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 8M2R8 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LPP (Q93052). MSHPSWLPPKSTGEPLGHVPARMETTHSFGNPSISVSTQQPPKKFAPVVAPKPKYNPYKQPGGEGDFLPPPPPPLDDSSALPSISGNFPPPPPLDEEAFK |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | LPP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot HIC5/TGFB1I1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HIC5_AF5626_Western_Blot_5782.jpg)
![Immunocytochemistry HIC5/TGFB1I1 Antibody [Unconjugated]](https://images.novusbio.com/images2/HIC5_AF5626_Immunocytochemistry__Immunofluorescence_19725.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for LPP Antibody (NBP3-15690)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LPP |
![Immunohistochemistry-Paraffin: LPP Antibody (8M2R8) [NBP3-15690] - Immunohistochemistry of paraffin-embedded human liver cancer using LPP Rabbit mAb (NBP3-15690) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/LPP-Antibody-8M2R8-Immunohistochemistry-Paraffin-NBP3-15690-img0001.jpg "Immunohistochemistry-Paraffin: LPP Antibody (8M2R8) [NBP3-15690] - Immunohistochemistry of paraffin-embedded human liver cancer using LPP Rabbit mAb (NBP3-15690) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Western Blot: LPP Antibody (8M2R8) [LPP] - Western blot analysis of various lysates using LPP Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 5s.](http://images.novusbio.com/fullsize/nbp3-15690_rabbit-lpp-mab-8m2r8-52202517361258.jpg "Western Blot: LPP Antibody (8M2R8) [LPP] - Western blot analysis of various lysates using LPP Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 5s.")
![Simple Western HMGA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HMGA2_AF3184_Simple_Western_16679.jpg)
![Western Blot HMGA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HMGA2_AF3184_Western_Blot_7403.jpg)
![Immunocytochemistry HMGA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3184_human-mouse-hmga2-affinity-purified-polyclonal-ab-immunocytochemistry-4122020143513.jpg)
![Immunohistochemistry Complement Factor H Antibody [Unconjugated]](https://images.novusbio.com/images2/Complement_Factor_H_AF4779_Immunohistochemistry_7182.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")