![Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LONP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/LONP1-Antibody-Western-Blot-NBP1-81734-img0019.jpg "Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LONP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | Hu, Mu, Rt, DrSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LONP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/16321.jpg)
![Knockout Validated STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Knockout_Validated_21968.jpg)
![Immunocytochemistry STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Immunocytochemistry__Immunofluorescence_17603.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for LONP1 Antibody (NBP1-81734)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LONP1 |
![Simple Western: LONP1 Antibody [NBP1-81734] - Simple Western lane view shows a specific band for LONP1 in 0.2 mg/ml of h. Kidney (left) , NIH-3T3 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/LONP1-Antibody-Simple-Western-NBP1-81734-img0003.jpg "Simple Western: LONP1 Antibody [NBP1-81734] - Simple Western lane view shows a specific band for LONP1 in 0.2 mg/ml of h. Kidney (left) , NIH-3T3 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/LONP1-Antibody-Immunohistochemistry-Paraffin-NBP1-81734-img0015.jpg "Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human fallopian tube shows granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/LONP1-Antibody-Immunohistochemistry-Paraffin-NBP1-81734-img0016.jpg "Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human fallopian tube shows granular cytoplasmic positivity in glandular cells.")
![Western Blot: LONP1 Antibody [NBP1-81734] - PINK1 accumulates upon knockdown of Lon. Western blot analysis of Lon protease (Lon), Mitochondrial transcription factor A (TFAM), Heat shock protein 60 (Hsp60) and Actin in whole head homogenate from control and Lon deficient animals. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pgen.1004279), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/LONP1-Antibody-Western-Blot-NBP1-81734-img0023.jpg "Western Blot: LONP1 Antibody [NBP1-81734] - PINK1 accumulates upon knockdown of Lon. Western blot analysis of Lon protease (Lon), Mitochondrial transcription factor A (TFAM), Heat shock protein 60 (Hsp60) and Actin in whole head homogenate from control and Lon deficient animals. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pgen.1004279), licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: LONP1 Antibody [NBP1-81734] - Staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/LONP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81734-img0009.jpg "Immunocytochemistry/Immunofluorescence: LONP1 Antibody [NBP1-81734] - Staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human tonsil shows granular cytoplasmic positivity.](http://images.novusbio.com/fullsize/LONP1-Antibody-Immunohistochemistry-Paraffin-NBP1-81734-img0018.jpg "Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human tonsil shows granular cytoplasmic positivity.")
![Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://images.novusbio.com/fullsize/LONP1-Antibody-Western-Blot-NBP1-81734-img0020.jpg "Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.")
![Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human pancreas shows granular cytoplasmic positivity.](http://images.novusbio.com/fullsize/LONP1-Antibody-Immunohistochemistry-Paraffin-NBP1-81734-img0017.jpg "Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human pancreas shows granular cytoplasmic positivity.")
![Simple Western: LONP1 Antibody [NBP1-81734] - Electropherogram image(s) of corresponding Simple Western lane view. LONP1 antibody was used at 1:20 dilution on h. Kidney and NIH-3T3 lysate(s).](http://images.novusbio.com/fullsize/LONP1-Antibody-Simple-Western-NBP1-81734-img0005.jpg "Simple Western: LONP1 Antibody [NBP1-81734] - Electropherogram image(s) of corresponding Simple Western lane view. LONP1 antibody was used at 1:20 dilution on h. Kidney and NIH-3T3 lysate(s).")
![Western Blot: LONP1 Antibody [NBP1-81734] - MTO1 defective cells exhibit proteostasis stress and an altered bioenergetic state. Representative immunoblot showing the expression of LONP1 in extracts of WT and MTO1 HF. Porin was used as a loading control. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29348686/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/nbp1-81734_rabbit-polyclonal-lonp1-antibody-2092023181153.jpg "Western Blot: LONP1 Antibody [NBP1-81734] - MTO1 defective cells exhibit proteostasis stress and an altered bioenergetic state. Representative immunoblot showing the expression of LONP1 in extracts of WT and MTO1 HF. Porin was used as a loading control. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29348686/) licensed under a CC-BY license.")
![Western Blot: LONP1 Antibody [NBP1-81734] - Altered mitochondrial features in cybrid cells carrying MELAS, MERRF, m.5514 A > G (mt-tRNATrp), m.1643A > G (mt-tRNAVal), & m.14487 T > C (ND6) mutations. (A) Representative western blot of LONP1, AFG3L2 & CLPP peptidases in mutant & wild type (WT) cybrid cells. The membrane was also probed with porin as a loading control. Full-length western blots & lower-exposure blots of porin are included in supplementary information. (B) Densitometric analysis of LONP1, AFG3L2 & CLPP normalized to porin & represented as fold change relative to WT (top). Quantitative data are from at least three independent experiments. Results from this analysis are also shown as a heatmap (bottom). The color & the corresponding value in log2 scale are depicted on the left. (C) Representative Blue Native-PAGE of OXPHOS complexes in mutant & WT cybrid cells. Full-length blots & lower-exposure blots for those with high contrast are included in supplementary information. (D) Densitometric analysis of OXPHOS complexes normalized to complex-II (loading control) & represented as fold change relative to WT. (E) Cellular ATP determination in mutant & WT cybrid cells. (F & G) Determination of Ca2+ (F) & ROS (G) by flow cytometry in mutant & WT cybrid cells with Fluo-3 & MitoSOX Red, respectively. All data are the mean ± SEM of at least three different experiments. Differences from WT values were found to be statistically significant at *p < 0.05, **p < 0.01 & ***p < 0.001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28740091), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81734_rabbit-polyclonal-lonp1-antibody-31020241612215.jpg "Western Blot: LONP1 Antibody [NBP1-81734] - Altered mitochondrial features in cybrid cells carrying MELAS, MERRF, m.5514 A > G (mt-tRNATrp), m.1643A > G (mt-tRNAVal), & m.14487 T > C (ND6) mutations. (A) Representative western blot of LONP1, AFG3L2 & CLPP peptidases in mutant & wild type (WT) cybrid cells. The membrane was also probed with porin as a loading control. Full-length western blots & lower-exposure blots of porin are included in supplementary information. (B) Densitometric analysis of LONP1, AFG3L2 & CLPP normalized to porin & represented as fold change relative to WT (top). Quantitative data are from at least three independent experiments. Results from this analysis are also shown as a heatmap (bottom). The color & the corresponding value in log2 scale are depicted on the left. (C) Representative Blue Native-PAGE of OXPHOS complexes in mutant & WT cybrid cells. Full-length blots & lower-exposure blots for those with high contrast are included in supplementary information. (D) Densitometric analysis of OXPHOS complexes normalized to complex-II (loading control) & represented as fold change relative to WT. (E) Cellular ATP determination in mutant & WT cybrid cells. (F & G) Determination of Ca2+ (F) & ROS (G) by flow cytometry in mutant & WT cybrid cells with Fluo-3 & MitoSOX Red, respectively. All data are the mean ± SEM of at least three different experiments. Differences from WT values were found to be statistically significant at *p < 0.05, **p < 0.01 & ***p < 0.001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28740091), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/STAT5b_AF2168_Western_Blot_5176.jpg)
![Simple Western STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16339.jpg)
![Chromatin Immunoprecipitation (ChIP) STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/STAT5b_AF2168_Chromatin_Immunoprecipitation_11246.jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Simple_Western_21000.jpg)
![Western Blot STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Western_Blot_5993.jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Knockout_Validated_21531.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")