Home » LLGL2 » LLGL2 Proteins » LLGL2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

LLGL2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for LLGL2 Protein (NBP1-81753PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

LLGL2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LLGL2.

Source: E. coli

Amino Acid Sequence: TKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARNSGTQSDGEEKQPGLVMERALLSDERVLKEIQSTLEGDRGSGNWRSHRAAVGCSLSNGGAE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LLGL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81753.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LLGL2 Recombinant Protein Antigen

  • HGLlethal giant larvae (Drosophila) homolog 2
  • human giant larvae homolog
  • lethal giant larvae homolog 2 (Drosophila)
  • lethal(2) giant larvae protein homolog 2
  • LGL2

Background

The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the protein's ability to localize cell fate determinants is regulated by the atypical protein kinase C (aPKC). In human, this protein interacts with aPKC-containing complexes and is cortically localized in mitotic cells. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Gastric Lipase
Antibody - BSA Free
NB110-60930
Western Blot Gastric Lipase Antibody - BSA Free
Species: Hu, Mu
Applications: WB
Pancreatic Lipase
Antibody
NBP2-38958
Immunohistochemistry-Paraffin Pancreatic Lipase Antibody
Immunohistochemistry-Paraffin Pancreatic Lipase Antibody
Immunohistochemistry-Paraffin Pancreatic Lipase Antibody
Species: Hu
Applications: IHC, IHC-P
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(848 Publications)
Species: Hu
Applications: BA
Tomosyn Antibody
NBP2-56176
Immunocytochemistry/ Immunofluorescence Tomosyn Antibody
Immunohistochemistry-Paraffin Tomosyn Antibody
Immunohistochemistry-Paraffin Tomosyn Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Stxbp5l Antibody -
Azide and BSA Free
NB100-91288
Stxbp5l Antibody - Azide and BSA Free
Species: Mu, Rt
Applications: IHC, IHC-P, WB
PPP1R3B Antibody
H00079660-B01P
Immunocytochemistry/ Immunofluorescence PPP1R3B Antibody
Western Blot PPP1R3B Antibody
Western Blot PPP1R3B Antibody
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, WB
OSTM1 Antibody
NBP1-81829
Western Blot OSTM1 Antibody
Immunohistochemistry-Paraffin OSTM1 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Glucagon Antibody
(181402) [Unconjugate ...
MAB1249
Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]
Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]
(1 Review)
(14 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
PSMC6 Antibody
(2C4)
H00005706-M02
Western Blot PSMC6 Antibody (2C4)
Immunocytochemistry/ Immunofluorescence PSMC6 Antibody (2C4)
Western Blot PSMC6 Antibody (2C4)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
RGL1 Antibody
(2D10)
H00023179-M01
Immunohistochemistry-Paraffin RGL1 Antibody (2D10)
Sandwich ELISA RGL1 Antibody (2D10)
Western Blot RGL1 Antibody (2D10)
(1 Publication)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
SLC22A3 Antibody
NBP1-83976
Immunohistochemistry-Paraffin SLC22A3 Antibody
Immunohistochemistry-Paraffin SLC22A3 Antibody
Immunohistochemistry-Paraffin SLC22A3 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Tight Junction
Protein 1 Antibody
NBP1-85047
Immunocytochemistry/ Immunofluorescence Tight Junction Protein 1 Antibody
Immunocytochemistry/ Immunofluorescence Tight Junction Protein 1 Antibody
Immunohistochemistry-Paraffin Tight Junction Protein 1 Antibody
(5 Reviews)
(20 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
ITK Antibody
NB100-807
Western Blot ITK Antibody
Immunocytochemistry/ Immunofluorescence ITK Antibody
Immunocytochemistry/ Immunofluorescence ITK Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
Lgl1 Antibody (5G2)
H00003996-M01
Western Blot Lgl1 Antibody (5G2)
ELISA Lgl1 Antibody (5G2)
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Galectin-1
Antibody [Unconjugate
AF1152
Intracellular Staining by Flow Cytometry Galectin-1 Antibody [Unconjugated]
Simple Western Galectin-1 Antibody [Unconjugated]
Immunohistochemistry Galectin-1 Antibody [Unconjugated]
(4 Reviews)
(22 Publications)
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Somatostatin
Antibody (7G5) - BSA
NBP2-37447
Immunofluorescence Somatostatin Antibody (7G5) - BSA Free
Immunohistochemistry-Paraffin Somatostatin Antibody (7G5) - BSA Free
ELISA Somatostatin Antibody (7G5) - BSA Free
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
E-Cadherin
Antibody [Unconjugate
AF748
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
Immunohistochemistry E-Cadherin Antibody [Unconjugated]
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
(142 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
LLGL2 Recombinant
Protein Antigen
NBP1-81753PEP
LLGL2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for LLGL2 Protein (NBP1-81753PEP) (0)

There are no publications for LLGL2 Protein (NBP1-81753PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LLGL2 Protein (NBP1-81753PEP) (0)

There are no reviews for LLGL2 Protein (NBP1-81753PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LLGL2 Protein (NBP1-81753PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LLGL2 Products

Array NBP1-81753PEP

Research Areas for LLGL2 Protein (NBP1-81753PEP)

Find related products by research area.

Blogs on LLGL2

There are no specific blogs for LLGL2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. ICC/IF image submitted by a verified customer review.
Tight Junction Protein 1 Antibody
NBP1-85047

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LLGL2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LLGL2