Home » LIN-28A » LIN-28A Proteins » LIN-28A Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

LIN-28A Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for LIN-28A Recombinant Protein Antigen (NBP3-21298PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

LIN-28A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LIN-28A

Source: E.coli

Amino Acid Sequence: KCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LIN28A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21298. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LIN-28A Recombinant Protein Antigen

  • CSDD1
  • CSDD1lin-28A
  • FLJ12457
  • lin-28 homolog (C. elegans)
  • lin-28 homolog A (C. elegans)
  • LIN28
  • LIN-28
  • LIN28A
  • LIN-28A
  • LIN28RNA-binding protein LIN-28
  • Tex17
  • ZCCHC1
  • ZCCHC1protein lin-28 homolog A
  • Zinc finger CCHC domain-containing protein 1
  • zinc finger, CCHC domain containing 1

Background

lin-28 homolog (C. elegans), also known as CSDD1, ZCCHC1. Entrez Protein NP_078950. LIN28 was first discovered in the nematode C. elegans. It is a heterochronic protein in C. elegans involved in the timing of developmental events and choice of stage specific cell fates. LIN28 expression has been found to be regulated post-transcriptionally by miRNAs in both nematodes and mammals. In humans it is expressed in embryonic stem cells and its expression decreases during differentiation. It is negatively regulated by retinoic acid in neuronal differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(77 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NANOGP8 Antibody
H00388112-B01P
Western Blot NANOGP8 Antibody
Species: Hu
Applications: WB
Nanog Antibody
[Unconjugated]
AF1997
Chromatin Immunoprecipitation (ChIP) Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
(5 Reviews)
(309 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(369 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
KLF4 Antibody
[Unconjugated]
AF3158
Chromatin Immunoprecipitation (ChIP) KLF4 Antibody [Unconjugated]
Immunocytochemistry KLF4 Antibody [Unconjugated]
Immunohistochemistry KLF4 Antibody [Unconjugated]
(2 Reviews)
(88 Publications)
Species: Mu
Applications: ChIP, ICC, IHC, WB
LIN-28B Antibody
NBP2-32352
Western Blot LIN-28B Antibody
Immunohistochemistry-Paraffin LIN-28B Antibody
Immunohistochemistry-Paraffin LIN-28B Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Dicer Antibody -
BSA Free
NBP1-71691
Immunocytochemistry/ Immunofluorescence Dicer Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Dicer Antibody - BSA Free
Immunohistochemistry Dicer Antibody - BSA Free
(1 Review)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
SLC22A3 Antibody
NBP1-83976
Immunohistochemistry-Paraffin SLC22A3 Antibody
Immunohistochemistry-Paraffin SLC22A3 Antibody
Immunohistochemistry-Paraffin SLC22A3 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Rex-1/ZFP42
Antibody (5E11A6) - B ...
NBP2-37357
ELISA Rex-1/ZFP42 Antibody (5E11A6) - BSA Free
Western Blot Rex-1/ZFP42 Antibody (5E11A6) - BSA Free
Western Blot Rex-1/ZFP42 Antibody (5E11A6) - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
BLIMP1/PRDM1
Antibody (3H2-E8) - B ...
NB600-235
Immunocytochemistry/ Immunofluorescence BLIMP1/PRDM1 Antibody (3H2-E8) - BSA Free
Flow Cytometry BLIMP1/PRDM1 Antibody (3H2-E8) - BSA Free
Immunocytochemistry/ Immunofluorescence BLIMP1/PRDM1 Antibody (3H2-E8) - BSA Free
(2 Reviews)
(52 Publications)
Species: Hu, Mu, Po
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
RNA Helicase A
Antibody
NB110-40579
Immunoprecipitation RNA Helicase A Antibody
Immunocytochemistry/ Immunofluorescence RNA Helicase A Antibody
Western Blot RNA Helicase A Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Drosha Antibody
NBP1-03349
Immunoprecipitation Drosha Antibody
Western Blot Drosha Antibody
(3 Reviews)
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
SALL4 Antibody
(6E3)
H00057167-M03
ELISA SALL4 Antibody (6E3)
Immunohistochemistry-Paraffin SALL4 Antibody (6E3)
Western Blot SALL4 Antibody (6E3)
(41 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
HMGA2 Antibody
[Unconjugated]
AF3184
Simple Western HMGA2 Antibody [Unconjugated]
Western Blot HMGA2 Antibody [Unconjugated]
Immunocytochemistry HMGA2 Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu
Applications: ICC, Simple Western, WB
REXO1 Antibody
NBP1-84863
Immunohistochemistry-Paraffin REXO1 Antibody
Western Blot REXO1 Antibody
Species: Hu
Applications: IHC, IHC-P

Publications for LIN-28A Recombinant Protein Antigen (NBP3-21298PEP) (0)

There are no publications for LIN-28A Recombinant Protein Antigen (NBP3-21298PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIN-28A Recombinant Protein Antigen (NBP3-21298PEP) (0)

There are no reviews for LIN-28A Recombinant Protein Antigen (NBP3-21298PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LIN-28A Recombinant Protein Antigen (NBP3-21298PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LIN-28A Products

Research Areas for LIN-28A Recombinant Protein Antigen (NBP3-21298PEP)

Find related products by research area.

Blogs on LIN-28A.

Check out the latest blog posts on LIN-28A.
Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of D3 mouse embryonic stem cell line, NTera-2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF017). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX2 Antibody [Unconjugated]
AF2018
LIN-28A was detected in immersion fixed BG01V human embryonic stem cells using 10 µg/mL Goat Anti-Human LIN-28A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3757) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counter-stained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
LIN-28A Antibody [Unconjugated]
AF3757
BG01V human embryonic stem cells were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Nanog/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human Nanog Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1997) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The nanog promoter was detected by standard PCR.
Nanog Antibody [Unconjugated]
AF1997

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LIN-28A Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LIN28A