Name: SALL4 Antibody (6E3)
Brand: Novus Biologicals
SKU: H00057167-M03
Price: 519 USD

- COVID-19 Research Tools
  
  Antibodies
  Primary Antibodies
  Conjugated Antibodies
  
  Sample Size Antibodies
  
  KO Validated Antibodies
  
  Recombinant Antibodies
  
  Antibody Sampler Packs
  
  Antibody Pairs
  
  Secondary Antibodies
  
  Isotype Control Antibodies
  
  Proteins and Peptides
  Peptides & Proteins
  
  Blocking Peptides
  
  Biologically Active Proteins
  
  Lysates and Cell Lines
  Lysates
  
  Stem Cell Lines
- Kits
  Antibody Labeling Kits
  
  ChIP Kits
  
  ELISA Kits
  
  Flow Cytometry Kits
  
  Activators and Inhibitors
  Inhibitors
  
  Activators
  
  Support Products
  Exosome Isolation
  
  Flow Cytometry Beads
  
  IHC Tissue Slides
  
  IHC Microarrays
  
  Western Blot Gels & Buffers
  
  Western Blot Membranes
  
  All Support Products
  
  Bulk and Custom
Products
Our Protocols
- Resources
  Protocols
  
  Video Protocols
  
  Troubleshooting Guides
  
  Posters and Literature
  
  Handbooks and Guides
  
  Calculators
  
  FAQs
  
  Blogs
  
  Diseases
  
  Whitepapers
  
  Antibody Concierge
  
  Webinars
- Tools
  Spectra Viewer
  
  Flow Cytometry Panel Builder
  
  Application
  ELISA
  
  Flow Cytometry
  
  Mass Cytometry (CyTOF)
  
  ICC
  
  IHC
  
  Western Blotting
  
  Interviews
  Faculty
  
  Postdoc
Resources
View Pathways
- By Research Area
  Apoptosis
  
  Autophagy
  
  Cancer
  
  Cell Biology
  
  Cellular Markers
  
  Epigenetics
  
  Epitope Tags
  
  Exosomes Research
  
  Hypoxia
  
  Immunology
  
  Microbiology
  
  Neuroscience
  
  Stem Cells
- By Pathway
  AKT
  
  Apoptosis
  
  Autophagy
  
  ERK1/2/5 Pathway
  
  Hedgehog
  
  Hippo
  
  JNK Pathway
  
  mTOR
  
  Necroptosis
  
  NFKB Signaling
  
  p38 Signaling
  
  TGF Beta
  
  TLR
Research Areas
Get Rewards
- Customer Care
  100% Guarantee
  
  Risk Free Testing
  
  Novus Rewards Program
  
  Publication Rewards Program
  
  New Lab Discount
  
  Scholarship
  
  Travel Grants
  
  Promotions
Customer Care
Novus Careers
- About us
  Careers
  
  Collaborations
  
  Events
  
  Novus Story
  
  Our Team
  
  Philanthropy
  
  Press Releases
  
  Why choose Novus
About Us
- Contact Us
  Customer Service
  
  Distributors
  
  Technical Support
Contact

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, Mu, RtSpecies Glossary
Applications	WB, ELISA, ICC/IF, IHC, ChIP
Clone	6E3
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Immunogen	SALL4 (NP_065169, 954 a.a. ~ 1053 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS
Specificity	SALL4 (6E3)
Isotype	IgG1 Kappa
Clonality	Monoclonal
Host	Mouse
Gene	SALL4
Purity	Protein A purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	Protein A purified

Publications using H00057167-M03	Applications	Species
Satsuki K, Takuo H, Tsuyoshi S et al. Distinct properties of pure- and mixed-type high-grade fetal lung adenocarcinomas by genetic profiling and transcription factor expression. Virchows Arch. 2021-11-30 [PMID: 34846611]

Taro A, Yuki Y, Rei N et al. Establishment and characterization of NCC-MRT1-C1: a novel cell line of malignant rhabdoid tumor. Hum Cell. 2022-08-05 [PMID: 35927606]
Takayuki O, Takeshi I, Ritsu Y et al. The first case of SMARCA4-deficient sarcoma of stomach. Clin J Gastroenterol. 2022-02-17 [PMID: 35175571]
Tomoko K, Mayuko I, Takeshi O et al. Neonatal streptozotocin treatment rapidly causes different subtype of hepatocellular carcinoma without persistent hyperglycemia in 4CS mice fed on a normal diet. Pathol Res Pract. 2021-07-21 [PMID: 34325313]
Hayato K, Kei K, Yoji K et al. Atezolizumab with bevacizumab, paclitaxel and carboplatin was effective for patients with SMARCA4-deficient thoracic sarcoma. Immunotherapy. 2021-05-25 [PMID: 34030451]
Shibahara J, Ando S, Hayashi A et al. Clinicopathologic characteristics of SALL4-immunopositive hepatocellular carcinoma. SpringerPlus Dec 10 2014
Nobuaki I, Shinwa T, Hidetoshi K et al. Early gastric cancer involving a pure enteroblastic differentiation component that was curatively resected via endoscopic submucosal dissection. Clin J Gastroenterol. 2020-03-29 [PMID: 32227292]
Junpei Y, Mami T, Satoshi N et al. A yolk sac tumor of the pancreas and derived xenograft model effectively responded to VIP chemotherapy. Pancreatology. 2019-12-31 [PMID: 31917123]
Zhao B, Zheng X, Tan X et al. Ku80 negatively regulates the expression of OCT4 via competitive binding to SALL4 and promoting lysosomal degradation of OCT4. Int J Biochem Cell Biol. 2019-12-06 [PMID: 31816404]
Zhao B, Wang Y, Tan X et al. Inflammatory Micro-environment Contributes to Stemness Properties and Metastatic Potential of HCC via the NF-?B/miR-497/SALL4 Axis. Mol Ther Oncolytics. 2019-12-20 [PMID: 31650028]
Tsuzuki S, Kataoka T, Ito H et al. A case of renal cell carcinoma unclassified with medullary phenotype without detectable gene deletion. Pathol Int. 2019-10-15 [PMID: 31617267]
Murakami T, Yao T, Yatagai N et al. Colorectal adenocarcinoma with enteroblastic differentiation: A clinicopathological study of five cases. Histopathology. 2019-08-20 [PMID: 31429980]
Ichimata S, Aoyagi D, Takehana T et al. A case of large cell neuroendocrine carcinoma exhibiting rhabdoid features in the esophagogastric junction. Pathol Int. 2019-06-24 [PMID: 31237049]
Terada Y, Jo N, Arakawa Y et al. Human Pluripotent Stem Cell-Derived Tumor Model Uncovers the Embryonic Stem Cell Signature as a Key Driver in Atypical Teratoid/Rhabdoid Tumor. Cell Rep. 2019-03-05 [PMID: 30840885]
Yamada R, Horiguchi SI, Onishi T et al. Early Gastric Cancer with Purely Enteroblastic Differentiation and No Conventional Adenocarcinoma Component. Case Rep Pathol 2018-08-28 [PMID: 30228922]
Fujimoto M, Matsuzaki I, Nishino M et al. HER2 is frequently overexpressed in hepatoid adenocarcinoma and gastric carcinoma with enteroblastic differentiation: a comparison of 35 cases to 334 gastric carcinomas of other histological types. J Clin Pathol 2018-01-05 [PMID: 29305518]
Shi H, Xu X, Zhang B et al. 3,3'-Diindolylmethane stimulates exosomal Wnt11 autocrine signaling in human umbilical cord mesenchymal stem cells to enhance wound healing. Theranostics 2017-04-10 [PMID: 28529644]
Yoshida A, Kobayashi E, Kubo T et al. Clinicopathological and molecular characterization of SMARCA4-deficient thoracic sarcomas with comparison to potentially related entities. Mod Pathol 2017-03-03 [PMID: 28256572]
Matsumoto K, Ueyama H, Matsumoto K et al. Clinicopathological features of alpha-fetoprotein producing early gastric cancer with enteroblastic differentiation. World J Gastroenterol 2016-09-28 [PMID: 27688662]
Bie Q, Sun C, Gong A et al. Non-tumor tissue derived interleukin-17B activates IL-17RB/AKT/beta-catenin pathway to enhance the stemness of gastric cancer. Sci Rep 2016-05-05 [PMID: 27146881] (WB)	WB
Kilic E, Tennstedt P, Hogner A et al. The zinc-finger transcription factor SALL4 is frequently expressed in human cancers: association with clinical outcome in squamous cell carcinoma but not in adenocarcinoma of the esophagus. Virchows Arch 2016-01-27 [PMID: 26818834]
Chapman KM, Medrano GA, Chaudhary J, Hamra FK. NRG1 and KITL signal downstream of retinoic acid in the germline to support soma-free syncytial growth of differentiating spermatogonia. Cell Death Discov. 2015-10-05 [PMID: 26500786]
Shibahara J, Ando S, Hayashi A et al. Clinicopathologic characteristics of SALL4-immunopositive hepatocellular carcinoma. SpringerPlus. 2014-01-01 [PMID: 26034695]
Tajima S, Koda K. Germinoma with an extensive rhabdoid cell component centered at the corpus callosum. Med Mol Morphol 2017-03-27 [PMID: 26012485]
Murakami T, Yao T, Mitomi H et al. Clinicopathologic and immunohistochemical characteristics of gastric adenocarcinoma with enteroblastic differentiation: a study of 29 cases. Gastric Cancer 2016-04-01 [PMID: 25893262]
Kohashi K, Yamada Y, Hotokebuchi Y et al. ERG and SALL4 expressions in SMARCB1/INI1-deficient tumors: a useful tool for distinguishing epithelioid sarcoma from malignant rhabdoid tumor. Human Pathology(2014). 2014-01-01 [PMID: 25479928]
Yoshida A, Asano N, Kawai A et al. Differential SALL4 Immunoexpression in Malignant Rhabdoid Tumours and Epithelioid Sarcomas. Histopathology. 2014-05-12 [PMID: 24827994]
Osada M, Aishima S, Hirahashi M et al. Combination of hepatocellular markers is useful for prognostication in gastric hepatoid adenocarcinoma. Hum Pathol. 2014-02-20 [PMID: 24767858]
Liu L, Souto J, Liao W et al. Histone lysine-specific demethylase 1 (LSD1) protein is involved in Sal-like protein 4 (SALL4)-mediated transcriptional repression in hematopoietic stem cells. J Biol Chem 2013-11-29 [PMID: 24163373] (ICC/IF, Chemotaxis, WB, Mouse)	ICC/IF, Chemotaxis, WB	Mouse
Fujimoto M, Sumiyoshi S, Yoshizawa A et al. SALL4 immunohistochemistry in non-small cell lung carcinomas. Histopathology. 2013-08-01 [PMID: 24117842]
Sha Zeng S, Yamashita T, Kondo M et al. The Transcription Factor SALL4 Regulates Stemness of EpCAM-positive Hepatocellular Carcinoma. J Hepatol. 2013-08-28 [PMID: 24012616]
Ota Y, Iihara K, Ryu T et al. Metastatic seminomas in lymph nodes: CD10 immunoreactivity can be a pitfall of differential diagnosis. Int J Clin Exp Pathol. 2013-02-15 [PMID: 23411938]
Ikeda H, Sato Y, Yoneda N et al. alpha-Fetoprotein-producing gastric carcinoma and combined hepatocellular and cholangiocarcinoma show similar morphology but different histogenesis with respect to SALL4 expression. Hum Pathol. 2011-11-11 [PMID: 22516245]
Iwamoto N, Ishida M, Yoshida K et al. Mediastinal seminoma: A case report with special emphasis on sall4 as a new immunocytochemical marker. Diagn Cytopathol. 2012-02-01 [PMID: 22298374]
Meguro S, Yasuda M. alpha-Fetoprotein-producing ovarian tumor in a postmenopausal woman with germ cell differentiation. Ann Diagn Pathol. 2011-07-14 [PMID: 22056036]
Clark PE, Polosukhina D, Love H et al. Beta-Catenin and K-RAS Synergize to Form Primitive Renal Epithelial Tumors with Features of Epithelial Wilms' Tumors. Am J Pathol. 2011-10-08 [PMID: 21983638]
Deisch J, Raisanen J, Rakheja D. Immunoexpression of SALL4 in Wilms Tumors and Developing Kidney. Pathol Oncol Res. 2011-01-22 [PMID: 21258884]
Sangoi AR, Karamchandani J, Lane B et al. Specificity of brachyury in the distinction of chordoma from clear cell renal cell carcinoma and germ cell tumors: a study of 305 cases. Mod Pathol. 2010-11-19 [PMID: 21102418]
Forte A, Schettino MT, Finicelli M et al. Expression pattern of stemness-related genes in human endometrial and endometriotic tissues. Mol Med. 2009-08-17 [PMID: 19690622]
Cauffman G, De Rycke M, Sermon K et al. Markers that define stemness in ESC are unable to identify the totipotent cells in human preimplantation embryos. Hum Reprod. 2008-09-29 [PMID: 18824471]
Show All 41 Publications. Collapse Publications.

SALL4 Antibody (6E3)

Species Glossary

Images

Product Details

Order Details

SALL4 Antibody (6E3) Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for SALL4 Antibody (6E3)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for SALL4 Antibody (H00057167-M03)(41)

Reviews for SALL4 Antibody (H00057167-M03) (0)

Product General Protocols

Video Protocols

FAQs for SALL4 Antibody (H00057167-M03) (0)

Secondary Antibodies

Isotype Controls

Additional SALL4 Products

Blogs on SALL4

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics

Gene Symbol	SALL4
Entrez	57167(Human)
OMIM	607323(Human)
Uniprot	NP_065169(Human)