Lhx8 Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human LHX8 (NP_001001933.1). MQILSRCQGLMSEECGRTTALAAGRTRKGAGEEGLVSPEGAGDEDSCSSSAPLSPSSSPRSMASGSGCPPGKCVCNSCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSLGRHTSCYIKDKDIFCKLDYFRRYGTRCSRCGRHIHSTDWVRRAKGNVYHLACFACFSCKRQLSTGEEFALVEEKVLCRVHYDCMLDNLKREVENGNGISVEGALLTEQDVN |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
LHX8 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50-1:200
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS with 50% glycerol, pH7.3. |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Lhx8 Antibody - BSA Free
Background
Members of the LIM homeobox gene family, such as LHX8, encode transcription regulators that share common structuralfeatures. They all contain 2 tandemly repeated cysteine-rich double-zinc finger motifs, called LIM domains, inaddition to a homeodomain. The homeodomain is a DNA-binding domain, and the LIM domains are essential for regulatingthe activity of these molecules by interacting with other proteins. Members of the LIM homeobox gene family arerequired for the patterning or the specification and differentiation of different cell types during embryonicdevelopment (Zhao et al., 1999 (PubMed 10611327)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: ELISA, KD, WB
Species: Mu
Applications: BA
Species: Mu
Applications: BA
Species: Mu
Applications: WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC/IF
Publications for Lhx8 Antibody (NBP3-04542) (0)
There are no publications for Lhx8 Antibody (NBP3-04542).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Lhx8 Antibody (NBP3-04542) (0)
There are no reviews for Lhx8 Antibody (NBP3-04542).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Lhx8 Antibody (NBP3-04542) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Lhx8 Products
Research Areas for Lhx8 Antibody (NBP3-04542)
Find related products by research area.
|
Blogs on Lhx8