![Western Blot: LHX6 Antibody [NB200-526] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%](http://images.novusbio.com/fullsize/LHX6-Antibody-Western-Blot-NB200-526-img0007.jpg "Western Blot: LHX6 Antibody [NB200-526] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 1 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human LHX6. Peptide Sequence LSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFS. The peptide sequence for this immunogen was taken from within the described region. |
| Localization | Nuclear |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LHX6 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | WB: Use in 5% skim milk / PBS buffer. Detects a band of approximately 50 kDa. Optimal dilutions/concentrations should be determined by the end user. |
| Theoretical MW | 40 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: LHX6 Antibody [NB200-526] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.](http://images.novusbio.com/fullsize/LHX6-Antibody-Immunohistochemistry-Paraffin-NB200-526-img0003.jpg "Immunohistochemistry-Paraffin: LHX6 Antibody [NB200-526] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.")
![Western Blot: LHX6 Antibody [NB200-526] - HepG2 cell lysate, Antibody Titration: 1.0ug/ml](http://images.novusbio.com/fullsize/LHX6-Antibody-Western-Blot-NB200-526-img0002.jpg "Western Blot: LHX6 Antibody [NB200-526] - HepG2 cell lysate, Antibody Titration: 1.0ug/ml")
![Western Blot: LHX6 Antibody [NB200-526] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize/LHX6-Antibody-Western-Blot-NB200-526-img0005.jpg "Western Blot: LHX6 Antibody [NB200-526] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml")
![SDS-PAGE FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF-8_423-F8_332.jpg)
![Bioactivity FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF8_423F8_1438.jpg)
![Cell Culture FGF-8 [Unconjugated]](https://images.novusbio.com/images/423-f8_recombinant-human-mouse-fgf-8b-protein-cell-culture-1052024145159..jpg)
![Western Blot MSX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/MSX1_AF5045_Western_Blot_5607.jpg)
![Immunohistochemistry MSX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/MSX1_AF5045_Immunohistochemistry_15258.jpg)
![Western Blot MSX1 Antibody [Unconjugated]](https://images.novusbio.com/images/af5045_human-mouse-msx1-affinity-purified-polyclonal-ab-41202412402511.jpg)
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![Simple Western Islet-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Islet1_AF1837_Simple_Western_21249.jpg)
![Western Blot Islet-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Islet1_AF1837_Western_Blot_21254.jpg)
![Immunocytochemistry Islet-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Islet1_AF1837_Immunocytochemistry__Immunofluorescence_17786.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")