Home » LEF1 » LEF1 Proteins » Recombinant Human LEF1 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human LEF1 GST (N-Term) Protein

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Func, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human LEF1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-399 of Human LEF1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
LEF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • In vitro assay
  • Protein Array
  • Western Blot
Application Notes
Use in In vitro assay reported in scientific literature (PMID 24816797)
Theoretical MW
69.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using H00051176-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LEF1 GST (N-Term) Protein

  • DKFZp586H0919
  • FLJ46390
  • LEF1
  • LEF-1
  • lymphoid enhancer-binding factor 1
  • T cell-specific transcription factor 1-alpha
  • TCF10
  • TCF1ALPHA
  • TCF1-alpha
  • TCF7L3

Background

LEF1( AAH50632, 1 a.a. - 400 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

beta-Catenin
Antibody [Unconjugate
AF1329
Western Blot beta-Catenin Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]
Simple Western beta-Catenin Antibody [Unconjugated]
(2 Reviews)
(33 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Immunohistochemistry-Paraffin HNF-4 alpha/NR2A1 Antibody
Immunohistochemistry-Paraffin HNF-4 alpha/NR2A1 Antibody
Western Blot HNF-4 alpha/NR2A1 Antibody
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
beta-Catenin
Antibody [Unconjugate
AF1329
Western Blot beta-Catenin Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]
Simple Western beta-Catenin Antibody [Unconjugated]
(2 Reviews)
(33 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
TCF7/TCF1 Antibody
(812145) [Unconjugate ...
MAB8224
Western Blot TCF7/TCF1 Antibody (812145) [Unconjugated]
Intracellular Staining by Flow Cytometry TCF7/TCF1 Antibody (812145) [Unconjugated]
(3 Publications)
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
TCF7L2 Antibody
(3A4)
H00006934-M06
ELISA TCF7L2 Antibody (3A4)
Immunocytochemistry/ Immunofluorescence TCF7L2 Antibody (3A4)
Immunohistochemistry-Paraffin TCF7L2 Antibody (3A4)
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
HNF1 Antibody
NBP1-33596
Western Blot HNF1 Antibody
Western Blot HNF1 Antibody
Immunoprecipitation HNF1 Antibody
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/ Immunofluorescence APC Antibody - BSA Free
Flow Cytometry APC Antibody - BSA Free
Immunohistochemistry-Paraffin APC Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TCF7L1/TCF3
Antibody
AF6116
Immunocytochemistry TCF7L1/TCF3 Antibody
Western Blot TCF7L1/TCF3 Antibody
(2 Publications)
Species: Hu
Applications: ICC, WB
TCF4 Antibody (1G4)
H00006925-M03
ELISA TCF4 Antibody (1G4)
Immunocytochemistry/ Immunofluorescence TCF4 Antibody (1G4)
Western Blot TCF4 Antibody (1G4)
(1 Review)
(7 Publications)
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
(1 Review)
(9 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
E-Cadherin
Antibody [Unconjugate
AF748
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
Immunohistochemistry E-Cadherin Antibody [Unconjugated]
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
(142 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Wnt-3a
[Unconjugated]
5036-WN
Bioactivity Wnt-3a [Unconjugated]
Bioactivity Wnt-3a [Unconjugated]
Cell Culture Wnt-3a [Unconjugated]
(369 Publications)
Species: Hu
Applications: BA, BA
Wnt-1 Antibody
(10C8) - BSA Free
NBP1-51575
Immunocytochemistry/ Immunofluorescence Wnt-1 Antibody (10C8) - BSA Free
Immunohistochemistry-Paraffin Wnt-1 Antibody (10C8) - BSA Free
Western Blot Wnt-1 Antibody (10C8) - BSA Free
(2 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Axin-1 Antibody
AF3287
Western Blot Axin-1 Antibody
(15 Publications)
Species: Hu, Mu, Rt
Applications: WB
Coagulation Factor
XIV/Protein C Antibod ...
AF4885
Coagulation Factor XIV/Protein C Antibody
(2 Publications)
Species: Mu
Applications: IP, WB
TCF-3/E2A Antibody
(826927) [Unconjugate ...
MAB7650
Western Blot TCF-3/E2A Antibody (826927) [Unconjugated]
Immunohistochemistry TCF-3/E2A Antibody (826927) [Unconjugated]
(2 Publications)
Species: Mu
Applications: IHC, WB
Recombinant Human
LEF1 GST (N-Term) Pro ...
H00051176-P01
Recombinant Human LEF1 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, Func, MA, AP

Publications for LEF1 Recombinant Protein (H00051176-P01)(2)

We have publications tested in 1 application: In-vitro.


Filter By Application
In-vitro
(1)
All Applications
Filter By Species
All Species

Reviews for LEF1 Recombinant Protein (H00051176-P01) (0)

There are no reviews for LEF1 Recombinant Protein (H00051176-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LEF1 Recombinant Protein (H00051176-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LEF1 Products

Research Areas for LEF1 Recombinant Protein (H00051176-P01)

Find related products by research area.

Blogs on LEF1.

Check out the latest blog posts on LEF1.
The role of Wnts in neuroinflammation
By Michalina Hanzel, PhDThe multifaceted roles of the Wnt family of glycoproteins have been extensively characterized throughout embryonic development and adult homeostasis. The highly conserved, cell- and tissue- s...  Read full blog post.
Beta Catenin in Cell Adhesion and T-cell Signaling
Beta Catenin is a cytosolic, 88 kDa intracellular protein that tightly associates with cell surface cadherin glycoproteins. It is one member of the catenin family that includes alpha Catenin, beta Catenin, and gamma Catenin. Colocalization studies usi...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LEF1 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol LEF1