Immunogen | This LC3A antibody was developed against a recombinant LC3A protein corresponding to amino acids: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMS |
Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | MAP1LC3A |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||||
Control |
|
||||
Control Peptide |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Neuro2a Chloroquine Treated / Untreated Cell Lysate | |
HeLa Chloroquine Treated / Untreated Cell Lysate |
Secondary Antibodies |
Isotype Controls |
Research Areas for LC3A Antibody (NBP2-48512)Find related products by research area.
|
Read full blog post. |
Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease By Jamshed Arslan Pharm.D. Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy... Read full blog post. |
Nuclear LC3: Why is it there and what is it doing? By Christina Towers, PhD. Cells use the complex process of autophagy to degrade and recycle cytoplasmic material. There are over 20 proteins that have been implicated in this process and appropriately named core ... Read full blog post. |
Why LC3B Antibodies Make Ideal Autophagosomes Membrane Markers The human form of microtubule-associated protein light chain 3 (LC3) is expressed as 3 splice variants LC3A, LC3B, and LC3C.1 LC3B is a subunit of the MAP1A and MAP1B microtubule-binding proteins and plays a central role in autophagosome membrane stru... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | MAP1LC3A |