LBP Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LBP. Source: E. coli
Amino Acid Sequence: EGYLNFSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFNAELLEALLNYYI Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
LBP |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88371. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for LBP Recombinant Protein Antigen
Background
The protein encoded by the LBP gene is involved in the acute-phase immunologic response to gram-negative bacterialinfections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Togetherwith bactericidal permeability-increasing protein (BPI), the encoded protein binds LPS and interacts with the CD14receptor, probably playing a role in regulating LPS-dependent monocyte responses. Studies in mice suggest that theencoded protein is necessary for the rapid acute-phase response to LPS but not for the clearance of LPS fromcirculation. This protein is part of a family of structurally and functionally related proteins, including BPI, plasmacholesteryl ester transfer protein (CETP), and phospholipid transfer protein (PLTP). Finally, this gene is found onchromosome 20, immediately downstream of the BPI gene. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: Bind
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: AC
Publications for LBP Protein (NBP1-88371PEP) (0)
There are no publications for LBP Protein (NBP1-88371PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LBP Protein (NBP1-88371PEP) (0)
There are no reviews for LBP Protein (NBP1-88371PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for LBP Protein (NBP1-88371PEP) (0)
Additional LBP Products
Research Areas for LBP Protein (NBP1-88371PEP)
Find related products by research area.
|
Blogs on LBP