LAMP Antibody Summary
Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen |
Synthetic peptides corresponding to LSAMP(limbic system-associated membrane protein) The peptide sequence was selected from the N terminal of LSAMP.
Peptide sequence MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAI. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
LSAMP |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for LAMP Antibody
Background
LSAMP is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections.The protein encoded by this gene is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this encoded protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: IHC, WB
Species: Ca, Fe, Hu, Mu, Sh
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
Species: Ca, Hu
Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: BA
Species: Fe, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: ICC, IHC, IP, WB
Species: Hu
Applications: IHC, WB
Publications for LAMP Antibody (NBP1-59212) (0)
There are no publications for LAMP Antibody (NBP1-59212).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LAMP Antibody (NBP1-59212) (0)
There are no reviews for LAMP Antibody (NBP1-59212).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LAMP Antibody (NBP1-59212) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LAMP Products
Blogs on LAMP