![Western Blot: Lamin B1 Antibody [NBP3-03711] - Analysis of extracts of various cell lines, using Lamin B1 antibody at 1:1000 dilution.L929 cells were treated by staurosporine(1 uM) for 3 hour. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.Exposure time: 30s.](http://images.novusbio.com/fullsize/Lamin-B1-Antibody-Western-Blot-NBP3-03711-img0010.jpg "Western Blot: Lamin B1 Antibody [NBP3-03711] - Analysis of extracts of various cell lines, using Lamin B1 antibody at 1:1000 dilution.L929 cells were treated by staurosporine(1 uM) for 3 hour. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP, ChIP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 397-586 of human Lamin B1 (NP_005564.1). RVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LMNB1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 66 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Lamin B1 Antibody (NBP3-03711)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LMNB1 |
![Immunocytochemistry/Immunofluorescence: Lamin B1 Antibody [NBP3-03711] - Immunofluorescence analysis of NIH-3T3 cells using [KO Validated] Lamin B1 Rabbit pAb (NBP3-03711) at dilution of 100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Lamin-B1-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03711-img0012.jpg "Immunocytochemistry/Immunofluorescence: Lamin B1 Antibody [NBP3-03711] - Immunofluorescence analysis of NIH-3T3 cells using [KO Validated] Lamin B1 Rabbit pAb (NBP3-03711) at dilution of 100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP3-03711] - Immunohistochemistry of paraffin-embedded mouse brain using [KO] Lamin B1 antibody (NBP3-03711) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Lamin-B1-Antibody-Immunohistochemistry-Paraffin-NBP3-03711-img0015.jpg "Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP3-03711] - Immunohistochemistry of paraffin-embedded mouse brain using [KO] Lamin B1 antibody (NBP3-03711) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Western Blot: Lamin B1 Antibody [NBP3-03711] - Analysis of extracts of various cell lines, using Lamin B1 antibody at 1:1000 dilution.Jurkat cells were treated by Etoposide (25 uM) at 37c for 5 hours.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/Lamin-B1-Antibody-Western-Blot-NBP3-03711-img0009.jpg "Western Blot: Lamin B1 Antibody [NBP3-03711] - Analysis of extracts of various cell lines, using Lamin B1 antibody at 1:1000 dilution.Jurkat cells were treated by Etoposide (25 uM) at 37c for 5 hours.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.")
![Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP3-03711] - Immunohistochemistry of paraffin-embedded human breast using [KO] Lamin B1 antibody (NBP3-03711) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Lamin-B1-Antibody-Immunohistochemistry-Paraffin-NBP3-03711-img0013.jpg "Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP3-03711] - Immunohistochemistry of paraffin-embedded human breast using [KO] Lamin B1 antibody (NBP3-03711) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP3-03711] - Immunohistochemistry of paraffin-embedded rat brain using [KO] Lamin B1 antibody (NBP3-03711) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Lamin-B1-Antibody-Immunohistochemistry-Paraffin-NBP3-03711-img0014.jpg "Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP3-03711] - Immunohistochemistry of paraffin-embedded rat brain using [KO] Lamin B1 antibody (NBP3-03711) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunoprecipitation: Lamin B1 Antibody [NBP3-03711] - Analysis of 300ug extracts of MCF7 cells using 3ug Lamin B1 antibody. Western blot was performed from the immunoprecipitate using Lamin B1 antibody at a dilition of 1:1000.](http://images.novusbio.com/fullsize/Lamin-B1-Antibody-Immunoprecipitation-NBP3-03711-img0011.jpg "Immunoprecipitation: Lamin B1 Antibody [NBP3-03711] - Analysis of 300ug extracts of MCF7 cells using 3ug Lamin B1 antibody. Western blot was performed from the immunoprecipitate using Lamin B1 antibody at a dilition of 1:1000.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot ALS Antibody [Unconjugated]](https://images.novusbio.com/images2/ALS_AF1436_Western_Blot_17079.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")