![Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining in human bone marrow and skeletal muscle tissues using NBP1-80628 antibody. Corresponding KDM6A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/KDM6A-Antibody-Immunohistochemistry-Paraffin-NBP1-80628-img0020.jpg "Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining in human bone marrow and skeletal muscle tissues using NBP1-80628 antibody. Corresponding KDM6A RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT |
| Predicted Species | Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KDM6A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Jak1 Antibody (413104) [Unconjugated]](https://images.novusbio.com/images2/Jak1_MAB4260_Western_Blot_6164.jpg)
![Immunohistochemistry Jak1 Antibody (413104) [Unconjugated]](https://images.novusbio.com/images2/Jak1_MAB4260_Immunohistochemistry_7021.jpg)
![Intracellular Staining by Flow Cytometry Jak1 Antibody (413104) [Unconjugated]](https://images.novusbio.com/images2/Jak1_MAB4260_Flow_Cytometry_8448.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Yongkang Yang |
WB | Human | 02/26/2021 |
Summary
|
||||||||
Enlarge |
reviewed by:
Verified Customer |
IHC-P | Mouse | 01/19/2017 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
|
Breast cancer stem cells survive chemotherapy through S100A10-ANXA2-SPT6 interaction that epigenetically promotes OCT4-mediated stemness By Jamshed Arslan, Pharm D, PhDBreast cancer is the most common cancer among women that causes the greatest number of cancer-related deaths worldwide. After radiotherapy or cytotoxic chemotherapy like paclitax... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Yongkang Yang 02/26/2021 |
||
| Application: | WB | |
| Species: | Human |
| Verified Customer 01/19/2017 |
||
| Application: | IHC-P | |
| Species: | Mouse |
![Western Blot: KDM6A Antibody [NBP1-80628] - HMLE cells were transduced with either an empty vector (HMLE-Vector), or genes encoding the EMT-inducing transcription factors Snail (HMLE-Snail) or Twist (HMLE-Twist) [4]. Whole-cell lysates were analyzed by immunoblotting for KDM6A. beta-actin was used as a loading control. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29029452/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/KDM6A-Antibody-Western-Blot-NBP1-80628-img0022.jpg "Western Blot: KDM6A Antibody [NBP1-80628] - HMLE cells were transduced with either an empty vector (HMLE-Vector), or genes encoding the EMT-inducing transcription factors Snail (HMLE-Snail) or Twist (HMLE-Twist) [4]. Whole-cell lysates were analyzed by immunoblotting for KDM6A. beta-actin was used as a loading control. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29029452/) licensed under a CC-BY license.")
![Western Blot: KDM6A Antibody [NBP1-80628] - Analysis in human cell line HEK 293.](http://images.novusbio.com/fullsize/KDM6A-Antibody-Western-Blot-NBP1-80628-img0006.jpg "Western Blot: KDM6A Antibody [NBP1-80628] - Analysis in human cell line HEK 293.")
![Western Blot: KDM6A Antibody [NBP1-80628] - MCF-7 and MDA-MB-231 whole cell lysates (40 ug/lane). 10% SDS-PAGE. KDM6A Antibody (NBP1-80628) primary antibody at 1:1000, 4C, overnight. Western blot image submitted by a verified customer review.](http://images.novusbio.com/fullsize/KDM6A-Antibody-Western-Blot-NBP1-80628-img0021.jpg "Western Blot: KDM6A Antibody [NBP1-80628] - MCF-7 and MDA-MB-231 whole cell lysates (40 ug/lane). 10% SDS-PAGE. KDM6A Antibody (NBP1-80628) primary antibody at 1:1000, 4C, overnight. Western blot image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Red: UTX nuclear colocalization with DAPI (in blue). Image submitted by a verified customer review.](http://images.novusbio.com/fullsize/KDM6A-Antibody-Immunohistochemistry-Paraffin-NBP1-80628-img0012.jpg "Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Red: UTX nuclear colocalization with DAPI (in blue). Image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human bone marrow shows high expression.](http://images.novusbio.com/fullsize/KDM6A-Antibody-Immunohistochemistry-Paraffin-NBP1-80628-img0013.jpg "Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human bone marrow shows high expression.")
![Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human cervix shows moderate to strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/KDM6A-Antibody-Immunohistochemistry-Paraffin-NBP1-80628-img0016.jpg "Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human cervix shows moderate to strong nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/KDM6A-Antibody-Immunohistochemistry-Paraffin-NBP1-80628-img0017.jpg "Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize/KDM6A-Antibody-Immunohistochemistry-Paraffin-NBP1-80628-img0018.jpg "Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/KDM6A-Antibody-Immunohistochemistry-Paraffin-NBP1-80628-img0019.jpg "Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images2/EZH2_AF4767_Western_Blot_12571.jpg)
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images/af4767_human-mouse-ezh2-affinity-purified-polyclonal-ab-4120241240516.jpg)
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images/af4767_human-mouse-ezh2-affinity-purified-polyclonal-ab-4120241240219.jpg)
![Western Blot Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Western_Blot_5829.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11663.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11664.jpg)
![Knockout Validated Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Knockout_Validated_22540.jpg)
![Immunocytochemistry Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Immunocytochemistry__Immunofluorescence_19067.jpg)
![Western Blot Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Western_Blot_13853.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
