Reactivity | Hu, MuSpecies Glossary |
Applications | IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYS |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | JAG2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Jagged 2 Antibody (NBP1-86337)Find related products by research area.
|
Notch Antibody Proves Metastatic Lung Cancer Has a Jagged Edge We at Novus Biologicals are one of the leading antibody suppliers for cancer research. In a recent Notch antibody study, the Notch ligand Jagged 2 was found to promote the growth of metastatic lung cancer cells by inhibiting miR-200, which blocks epit... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | JAG2 |