![Western Blot: Jagged 2 Antibody [NBP1-58284] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize/Jagged-2-Antibody-Western-Blot-NBP1-58284-img0002.jpg "Western Blot: Jagged 2 Antibody [NBP1-58284] - Jurkat cell lysate, concentration 0.2-1 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to JAG2(jagged 2) The peptide sequence was selected from the N terminal of JAG2. Peptide sequence RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | JAG2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Publication using NBP1-58284 | Applications | Species |
|---|---|---|
| Peng, W, Chang, M Et al. Lyophilized powder of mesenchymal stem cell supernatant attenuates acute lung injury through the IL-6-p-STAT3-p63-JAG2 pathway. Stem Cell Res Ther 2021-03-29 [PMID: 33781349] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Jagged 2 Antibody (NBP1-58284)Find related products by research area.
|
|
Notch Antibody Proves Metastatic Lung Cancer Has a Jagged Edge We at Novus Biologicals are one of the leading antibody suppliers for cancer research. In a recent Notch antibody study, the Notch ligand Jagged 2 was found to promote the growth of metastatic lung cancer cells by inhibiting miR-200, which blocks epit... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: Jagged 2 Antibody [NBP1-58284] - Human Bronchial Epithelial Tissue Observed Staining: Membrane of bronchial epithelial tissue Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5](http://images.novusbio.com/fullsize/Jagged-2-Antibody-Immunohistochemistry-NBP1-58284-img0003.jpg "Immunohistochemistry: Jagged 2 Antibody [NBP1-58284] - Human Bronchial Epithelial Tissue Observed Staining: Membrane of bronchial epithelial tissue Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5")
![Immunocytochemistry Notch-4 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3847_human-notch-4-intracellular-domain-affinity-purified-pab-immunocytochemistry-3092021102949.jpg)
![Jagged 1 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Jagged 1 [Unconjugated]")
![Immunohistochemistry Notch-2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3735_human-notch-2-intracellular-domain-affinity-purified-pab-immunohistochemistry-1862024111356..jpg)
![Western Blot DLL4 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL4_AF1389_Western_Blot_15836.jpg)
![Immunocytochemistry DLL4 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL4_AF1389_Immunocytochemistry_15887.jpg)
![Immunohistochemistry DLL4 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL4_AF1389_Immunohistochemistry_24173.jpg)
![Immunohistochemistry DLL1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL1_AF3970_Immunohistochemistry_6817.jpg)
![Flow Cytometry DLL1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL1_AF3970_Flow_Cytometry_9303.jpg)
![Immunocytochemistry/ Immunofluorescence DLL1 Antibody [Unconjugated]](https://images.novusbio.com/images/af3970_mouse-rat-dll1-affinity-purified-polyclonal-ab-41202412403596.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")