![Western Blot: Jagged 2 Antibody (3K1I8) [NBP3-15726] - Western blot analysis of extracts of various cell lines, using Jagged 2 antibody (NBP3-15726) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/Jagged-2-Antibody-3K1I8-Western-Blot-NBP3-15726-img0001.jpg "Western Blot: Jagged 2 Antibody (3K1I8) [NBP3-15726] - Western blot analysis of extracts of various cell lines, using Jagged 2 antibody (NBP3-15726) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clone | 3K1I8 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Jagged 2 (Q9Y219). MRAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGG |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | JAG2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Jagged 2 Antibody (NBP3-15726)Find related products by research area.
|
|
Notch Antibody Proves Metastatic Lung Cancer Has a Jagged Edge We at Novus Biologicals are one of the leading antibody suppliers for cancer research. In a recent Notch antibody study, the Notch ligand Jagged 2 was found to promote the growth of metastatic lung cancer cells by inhibiting miR-200, which blocks epit... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | JAG2 |
![Immunocytochemistry Notch-4 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3847_human-notch-4-intracellular-domain-affinity-purified-pab-immunocytochemistry-3092021102949.jpg)
![Jagged 1 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Jagged 1 [Unconjugated]")
![Immunohistochemistry Notch-2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3735_human-notch-2-intracellular-domain-affinity-purified-pab-immunohistochemistry-1862024111356..jpg)
![Western Blot DLL4 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL4_AF1389_Western_Blot_15836.jpg)
![Immunocytochemistry DLL4 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL4_AF1389_Immunocytochemistry_15887.jpg)
![Immunohistochemistry DLL4 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL4_AF1389_Immunohistochemistry_24173.jpg)
![Immunohistochemistry DLL1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL1_AF3970_Immunohistochemistry_6817.jpg)
![Flow Cytometry DLL1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL1_AF3970_Flow_Cytometry_9303.jpg)
![Immunocytochemistry/ Immunofluorescence DLL1 Antibody [Unconjugated]](https://images.novusbio.com/images/af3970_mouse-rat-dll1-affinity-purified-polyclonal-ab-41202412403596.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")