![Immunocytochemistry/Immunofluorescence: ITM2B Antibody [NBP1-88354] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ITM2B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88354-img0008.jpg "Immunocytochemistry/Immunofluorescence: ITM2B Antibody [NBP1-88354] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCH |
| Predicted Species | Mouse (95%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ITM2B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-88354 | Applications | Species |
|---|---|---|
| Baron BW, Baron RM, Baron JM. The ITM2B (BRI2) gene is a target of BCL6 repression: Implications for lymphomas and neurodegenerative diseases. Biochim Biophys Acta 2015-05-01 [PMID: 25557390] (IF/IHC, WB, Human) | IF/IHC, WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for ITM2B Antibody (NBP1-88354)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ITM2B |
![Immunohistochemistry-Paraffin: ITM2B Antibody [NBP1-88354] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/ITM2B-Antibody-Immunohistochemistry-Paraffin-NBP1-88354-img0016.jpg "Immunohistochemistry-Paraffin: ITM2B Antibody [NBP1-88354] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: ITM2B Antibody [NBP1-88354] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/ITM2B-Antibody-Immunohistochemistry-Paraffin-NBP1-88354-img0014.jpg "Immunohistochemistry-Paraffin: ITM2B Antibody [NBP1-88354] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: ITM2B Antibody [NBP1-88354] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/ITM2B-Antibody-Immunohistochemistry-Paraffin-NBP1-88354-img0015.jpg "Immunohistochemistry-Paraffin: ITM2B Antibody [NBP1-88354] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: ITM2B Antibody [NBP1-88354] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-88354_rabbit-polyclonal-itm2b-antibody-immunohistochemistry-paraffin-13122024955..png "Immunohistochemistry-Paraffin: ITM2B Antibody [NBP1-88354] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Insulysin/IDE [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Insulysin/IDE [Unconjugated]")
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/Cystatin_C_MSCTC0_ELISA_321.jpg)
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/Cystatin_C_MSCTC0_ELISA_322.jpg)
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/DATA_Cystatin_C_MSCTC0_ELISA_1030.jpg)
![Bioactivity BMP-2 [Unconjugated]](https://images.novusbio.com/images/protein/355-bm_recombinant-human-mouse-rat-bmp-2-protein-bioactivity-181120209742.jpg)
![Western Blot Pentraxin 2/SAP Antibody [Unconjugated]](https://images.novusbio.com/images2/Pentraxin_2_AF2558_Western_Blot_15557.jpg)
![Simple Western Pentraxin 2/SAP Antibody [Unconjugated]](https://images.novusbio.com/images2/Pentraxin_2_AF2558_Simple_Western_17977.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")