![Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human parathyroid gland shows moderate positivity in glandular cells.](http://images.novusbio.com/fullsize/SPPL2a-Antibody-Immunohistochemistry-Paraffin-NBP1-87512-img0012.jpg "Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human parathyroid gland shows moderate positivity in glandular cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SPPL2A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SPPL2a Antibody (NBP1-87512)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SPPL2A |
![Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human kidney shows strong granular cytoplasmic positivity in cells of tubules.](http://images.novusbio.com/fullsize/SPPL2a-Antibody-Immunohistochemistry-Paraffin-NBP1-87512-img0004.jpg "Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human kidney shows strong granular cytoplasmic positivity in cells of tubules.")
![Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Analysis in human parathyroid gland and cerebral cortex tissues. Corresponding SPPL2A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SPPL2a-Antibody-Immunohistochemistry-Paraffin-NBP1-87512-img0008.jpg "Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Analysis in human parathyroid gland and cerebral cortex tissues. Corresponding SPPL2A RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/SPPL2a-Antibody-Immunohistochemistry-Paraffin-NBP1-87512-img0009.jpg "Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human cerebral cortex shows weak positivity.](http://images.novusbio.com/fullsize/SPPL2a-Antibody-Immunohistochemistry-Paraffin-NBP1-87512-img0010.jpg "Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human cerebral cortex shows weak positivity.")
![Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human colon shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/SPPL2a-Antibody-Immunohistochemistry-Paraffin-NBP1-87512-img0011.jpg "Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human colon shows moderate membranous positivity in glandular cells.")
![SDS-PAGE IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_668.jpg)
![Bioactivity IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_669.jpg)
![N/A IGFBP-3 [HRP]](https://images.novusbio.com/images2/DATA_IGFBP3_DGB300_ELISA_694.jpg)
![N/A IGFBP-3 [HRP]](https://images.novusbio.com/images2/IGFBP-3_DGB300_ELISA_104.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")