Novus Biologicals products are now on bio-techne.com

ISYNA1 Recombinant Protein Antigen

Images

 
There are currently no images for ISYNA1 Recombinant Protein Antigen (NBP2-48513PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

ISYNA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ISYNA1.

Source: E. coli

Amino Acid Sequence: VYIPEFIAANQSARADNLIPGSRAQQLEQIRRDIRDFRSSAGLDKVIVLWTANTERFCEVIPGLNDTAENLLRTIELGLEVSPSTLFAVASILEGCAFLNGSPQNTLVP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ISYNA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48513.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ISYNA1 Recombinant Protein Antigen

  • EC 5.5.1.4
  • hINO1
  • hIPS
  • INO1
  • INOS
  • inositol-3-phosphate synthase 1
  • IPSIPS 1
  • MI-1-P synthase
  • MIP synthase
  • Myo-inositol 1-phosphate synthase A1
  • Myo-inositol-1-phosphate synthase

Background

ISYNA1 is a gene that codes for a protein which is a key enzyme in the myo-inositol biosynthesis pathway which works to convert a glucose 6-phosphate into a 1-myo-inositol 1-phosphate, as well as a rate-limiting enzyme in the synthesis of all compounds containing inositol, and is highly expressed in the testis, ovary, heart, placenta, and pancreas. ISYNA1 has three isoforms with lengths of 558, 430, and 504 amino acids and weights of approximately 61, 47, and 55 kDa respectively. Current studies are being done on several diseases and disorders relating to this gene including synostosis, Whipple disease, cerebral palsy, osteonecrosis, bipolar disorder, candidiasis, cerebtitis, osteoarthritis, and malaria. ISYNA1 has also been shown to have interactions with NME2, PPP2CA, RPS15A, CAP2, and EEF2 in pathways such as inositol phosphate metabolism pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
NBP1-76917
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
M6000B
Species: Mu
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DY417
Species: Mu
Applications: ELISA
201-LB
Species: Hu
Applications: BA
NBP1-76919
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB

Publications for ISYNA1 Recombinant Protein Antigen (NBP2-48513PEP) (0)

There are no publications for ISYNA1 Recombinant Protein Antigen (NBP2-48513PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ISYNA1 Recombinant Protein Antigen (NBP2-48513PEP) (0)

There are no reviews for ISYNA1 Recombinant Protein Antigen (NBP2-48513PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ISYNA1 Recombinant Protein Antigen (NBP2-48513PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ISYNA1 Products

Research Areas for ISYNA1 Recombinant Protein Antigen (NBP2-48513PEP)

Find related products by research area.

Blogs on ISYNA1

There are no specific blogs for ISYNA1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ISYNA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ISYNA1