![Immunohistochemistry-Paraffin: ISLR Antibody [NBP2-14131] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/ISLR-Antibody-Immunohistochemistry-Paraffin-NBP2-14131-img0007.jpg "Immunohistochemistry-Paraffin: ISLR Antibody [NBP2-14131] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: LLIPDFGKLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPG |
| Predicted Species | Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ISLR |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-14131 | Applications | Species |
|---|---|---|
| Ikeda S, Tsuji S, Ohama T, Sato K Involvement of PP2A Methylation in the Adipogenic Differentiation of Bone Marrow Derived Mesenchymal Stem Cell J. Biochem. 2020-07-14 [PMID: 32663263] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ISLR |
![Immunohistochemistry-Paraffin: ISLR Antibody [NBP2-14131] - Staining of human prostate shows weak to moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ISLR-Antibody-Immunohistochemistry-Paraffin-NBP2-14131-img0004.jpg "Immunohistochemistry-Paraffin: ISLR Antibody [NBP2-14131] - Staining of human prostate shows weak to moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ISLR Antibody [NBP2-14131] - Staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/ISLR-Antibody-Immunohistochemistry-Paraffin-NBP2-14131-img0005.jpg "Immunohistochemistry-Paraffin: ISLR Antibody [NBP2-14131] - Staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: ISLR Antibody [NBP2-14131] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.](http://images.novusbio.com/fullsize/ISLR-Antibody-Immunohistochemistry-Paraffin-NBP2-14131-img0006.jpg "Immunohistochemistry-Paraffin: ISLR Antibody [NBP2-14131] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.")
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")