IFN-alpha WA/IFNA16 Antibody Summary
Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen |
IFNA16 (NP_002164.1, 1 a.a. - 189 a.a.) full-length human protein. MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQFQKAQAISAFHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLEACVTQEVGVEEIALMNEDSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD |
Specificity |
Reacts with interferon, alpha 16. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
IFNA16 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for IFN-alpha WA/IFNA16 Antibody
Background
IFNA16, also known as Interferon alpha-16, is a 189 amino acid protein that is 22 kDa, belongs to the alpha/beta interferon family, produced by macrophages has antiviral activities, and stimulates the production of protein kinase and oligoadenylate synthetase. Current research is being performed on several diseases and disorders including interferon, dengue hemorrhagic fever, immunodeficiency, hemorrhagic fever, autoimmune thyroiditis, measles, influenza, melanoma, tuberculosis, thyroiditis, hepatitis c, hepatitis, leukemia, and papillomatosis. This protein has shown to have interactions with IFNAR1, IFNAR2, IFNGR1, and IFNGR2 in pathways such as cytokine-cytokine receptor interaction, regulation of autophagy, toll-like receptor signaling pathway, RIG-I-like receptor signaling pathway, cytosolic DNA-sensing pathway, JAK-STAT pathway, all-trans-retinoic acid mediated apoptosis, and hemostasis pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Publications for IFN-alpha WA/IFNA16 Antibody (H00003449-D01P) (0)
There are no publications for IFN-alpha WA/IFNA16 Antibody (H00003449-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IFN-alpha WA/IFNA16 Antibody (H00003449-D01P) (0)
There are no reviews for IFN-alpha WA/IFNA16 Antibody (H00003449-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IFN-alpha WA/IFNA16 Antibody (H00003449-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IFN-alpha WA/IFNA16 Products
Blogs on IFN-alpha WA/IFNA16