Home » ICAM-3/CD50 » ICAM-3/CD50 Proteins » ICAM-3/CD50 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ICAM-3/CD50 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ICAM-3/CD50 Recombinant Protein Antigen (NBP2-57135PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

ICAM-3/CD50 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ICAM-3/CD50.

Source: E. coli

Amino Acid Sequence: AGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQIT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ICAM3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57135.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ICAM-3/CD50 Recombinant Protein Antigen

  • CD50 antigen
  • CD50
  • CDW50CDw50
  • ICAM3
  • ICAM-3
  • ICAM-Rintercellular adhesion molecule-3
  • intercellular adhesion molecule 3

Background

All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is constitutively and abundantly expressed by all leucocytes and may be the most important ligand for LFA-1 in the initiation of the immune response. It functions not only as an adhesion molecule, but also as a potent signalling molecule. ICAM 3 is the major ligand for LFA-1 in the resting state.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Integrin beta
2/CD18 Antibody [Unco ...
AF1730
Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]
Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]
Flow Cytometry Integrin beta 2/CD18 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Integrin alpha
L/CD11a Antibody (345 ...
MAB3595
Western Blot Integrin alpha L/CD11a Antibody (345913) [Unconjugated]
Simple Western Integrin alpha L/CD11a Antibody (345913) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
ICAM-1/CD54
Antibody [Unconjugate
AF796
Immunohistochemistry ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
(6 Reviews)
(88 Publications)
Species: Mu
Applications: AdBlk, IHC, WB
ICAM-2/CD102
Antibody [Unconjugate
AF244
Western Blot ICAM-2/CD102 Antibody [Unconjugated]
Western Blot ICAM-2/CD102 Antibody [Unconjugated]
(4 Publications)
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, WB
DC-SIGN/CD209
Antibody (120507) [Un ...
MAB161
Flow Cytometry DC-SIGN/CD209 Antibody (120507) [Unconjugated]
Flow Cytometry DC-SIGN/CD209 Antibody (120507) [Unconjugated]
Flow Cytometry DC-SIGN/CD209 Antibody (120507) [Unconjugated]
(1 Review)
(48 Publications)
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, WB
Lymphotoxin beta
R/TNFRSF3 Antibody
AF629
Lymphotoxin beta R/TNFRSF3 Antibody
(10 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(822 Publications)
Species: Hu
Applications: BA
CD11b Antibody -
BSA Free
NB110-89474
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
(12 Reviews)
(128 Publications)
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Doublecortin
Antibody
NBP1-72042
Western Blot Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB

DC-SIGNR/CD299/CLEC4M ...
MAB162
Flow Cytometry DC-SIGNR/CD299/CLEC4M Antibody (120604) [Unconjugated]
Immunocytochemistry/ Immunofluorescence DC-SIGNR/CD299/CLEC4M Antibody (120604) [Unconjugated]
Immunocytochemistry/ Immunofluorescence DC-SIGNR/CD299/CLEC4M Antibody (120604) [Unconjugated]
(18 Publications)
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow
E-Selectin/CD62E
Antibody (BBIG-E4) [U ...
BBA16
Immunohistochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]
Immunocytochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]
Flow Cytometry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]
(1 Review)
(60 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
L-Selectin/CD62L
Antibody (4G8) [Uncon ...
BBA24
Flow Cytometry L-Selectin/CD62L Antibody (4G8) [Unconjugated]
(9 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
CD31/PECAM-1
Antibody [Unconjugate
AF3628
Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]
Flow Cytometry CD31/PECAM-1 Antibody [Unconjugated]
Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]
(6 Reviews)
(512 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(52 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
B7-1/CD80 Antibody
(37711) [Unconjugated ...
MAB140
Flow Cytometry B7-1/CD80 Antibody (37711) [Unconjugated]
Immunohistochemistry B7-1/CD80 Antibody (37711) [Unconjugated]
Dual RNAscope ISH-IHC Compatible B7-1/CD80 Antibody (37711) [Unconjugated]
(26 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut

Publications for ICAM-3/CD50 Recombinant Protein Antigen (NBP2-57135PEP) (0)

There are no publications for ICAM-3/CD50 Recombinant Protein Antigen (NBP2-57135PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ICAM-3/CD50 Recombinant Protein Antigen (NBP2-57135PEP) (0)

There are no reviews for ICAM-3/CD50 Recombinant Protein Antigen (NBP2-57135PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ICAM-3/CD50 Recombinant Protein Antigen (NBP2-57135PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ICAM-3/CD50 Products

Research Areas for ICAM-3/CD50 Recombinant Protein Antigen (NBP2-57135PEP)

Find related products by research area.

Blogs on ICAM-3/CD50

There are no specific blogs for ICAM-3/CD50, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
CD31/PECAM-1 was detected in immersion fixed frozen sections of mouse embryo (E13.5) using Goat Anti-Human/Mouse/Rat CD31/PECAM-1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3628) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; NL001) and counterstained with DAPI (blue). Specific staining was localized to developing endothelium. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
CD31/PECAM-1 Antibody [Unconjugated]
AF3628
Immunocytochemistry/Immunofluorescence: CD11b Antibody - BSA Free [NB110-89474] - Raw264.7 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with CD11b Antibody conjugated to Alexa Fluor 488 (NB110-89474AF488) at 5 ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
CD11b Antibody - BSA Free
NB110-89474

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ICAM-3/CD50 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ICAM3