Home » ICA1 » ICA1 Proteins » ICA1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ICA1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ICA1 Recombinant Protein Antigen (NBP2-56868PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

ICA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ICA1.

Source: E. coli

Amino Acid Sequence: HESFKGYQPYEFTTLKSLQDPMKKLVEKEEKKKINQQESTDAAVQEPSQLISLEEENQRKESSSFK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ICA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56868.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ICA1 Recombinant Protein Antigen

  • diabetes mellitus type I autoantigen
  • ICA1
  • ICA69
  • ICAp69
  • ICAp69Islet cell autoantigen p69,69 kDa islet cell autoantigen
  • islet cell autoantigen 1 (69kD)
  • islet cell autoantigen 1 isoform
  • islet cell autoantigen 1
  • islet cell autoantigen 1, 69kDa
  • p69

Background

ICA1 is a gene that codes for a protein that is an autoantigen and may play a role in neurotransmitter secretion and is expressed abundantly in the pancreas, heart and brain, with a length of 483 amino acids and a weight of approximately 55 kDa. Current studies are being done on several diseases and disorders related to this gene including diabetes mellitus, Sjogren's syndrome, rehumatiod arthritis, insulinoma, vitiligo, and thyroiditis. ICA1 has also been shown to have interactions with KRT33B, STK16, CNTF, MKKS, and MYC in pathways such as the type 1 diabetes mellitus pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
ATN1 Antibody -
BSA Free
NBP1-90044
Immunocytochemistry/ Immunofluorescence ATN1 Antibody - BSA Free
Immunohistochemistry-Paraffin ATN1 Antibody - BSA Free
Immunohistochemistry-Paraffin ATN1 Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
GAD2/GAD65
Antibody [Unconjugate
AF2247
Immunohistochemistry GAD2/GAD65 Antibody [Unconjugated]
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
p63/TP73L Antibody
[Unconjugated]
AF1916
Immunohistochemistry p63/TP73L Antibody [Unconjugated]
Immunocytochemistry p63/TP73L Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]
(1 Review)
(24 Publications)
Species: Hu
Applications: ICC, IHC, WB
EBNA1BP2 Antibody
- BSA Free
NBP1-84022
Immunocytochemistry/ Immunofluorescence EBNA1BP2 Antibody - BSA Free
Western Blot EBNA1BP2 Antibody - BSA Free
Western Blot EBNA1BP2 Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(56 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
IL-9 [Unconjugated]
409-ML
IL-9 [Unconjugated]
(13 Publications)
Species: Mu
Applications: BA
GEF-H1 Antibody -
BSA Free
NBP2-21577
Western Blot GEF-H1 Antibody - BSA Free
Western Blot GEF-H1 Antibody - BSA Free
Western Blot GEF-H1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
CDP/CUTL1 Antibody
(2A10) - Azide and BS ...
H00001523-M01
Western Blot CDP/CUTL1 Antibody (2A10) - Azide and BSA Free
Immunohistochemistry-Paraffin CDP/CUTL1 Antibody (2A10) - Azide and BSA Free
ELISA CDP/CUTL1 Antibody (2A10) - Azide and BSA Free
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
LANCL1 Antibody -
BSA Free
NBP1-81796
Immunocytochemistry/ Immunofluorescence LANCL1 Antibody - BSA Free
Immunohistochemistry-Paraffin LANCL1 Antibody - BSA Free
Immunohistochemistry-Paraffin LANCL1 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
p40 Antibody - BSA
Free
NBP1-32956
Immunocytochemistry/ Immunofluorescence p40 Antibody - BSA Free
Immunohistochemistry-Paraffin p40 Antibody - BSA Free
Western Blot p40 Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
PSMD7 Antibody -
BSA Free
NBP2-38780
Immunocytochemistry/ Immunofluorescence PSMD7 Antibody - BSA Free
Immunohistochemistry-Paraffin PSMD7 Antibody - BSA Free
Western Blot PSMD7 Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RPSA Antibody
(RPSA/2699) - Azide a ...
NBP2-79854
Immunohistochemistry-Paraffin RPSA Antibody (RPSA/2699) - Azide and BSA Free
Immunohistochemistry-Paraffin RPSA Antibody (RPSA/2699) - Azide and BSA Free
Immunohistochemistry-Paraffin RPSA Antibody (RPSA/2699) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
PMEL17/SILV
Antibody (HMB45)
NBP2-44520
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Immunohistochemistry PMEL17/SILV Antibody (HMB45)
(8 Publications)
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
IGFBP-rp1/IGFBP-7
Antibody [Unconjugate ...
AF1334
Western Blot IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]
Immunohistochemistry IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]
(13 Publications)
Species: Hu
Applications: IHC, WB
Glutamine
Synthetase Antibody
NB110-41404
Immunocytochemistry/ Immunofluorescence Glutamine Synthetase Antibody
Western Blot Glutamine Synthetase Antibody
Immunohistochemistry Glutamine Synthetase Antibody
(1 Review)
(11 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
SART3 Antibody
NB100-74648
Immunohistochemistry-Paraffin SART3 Antibody
Immunohistochemistry-Paraffin SART3 Antibody
Western Blot SART3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
OAS3 Antibody -
BSA Free
NBP1-85841
Immunocytochemistry/ Immunofluorescence OAS3 Antibody - BSA Free
Immunohistochemistry-Paraffin OAS3 Antibody - BSA Free
Immunohistochemistry-Paraffin OAS3 Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ICA1 Recombinant
Protein Antigen
NBP2-56868PEP
ICA1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ICA1 Recombinant Protein Antigen (NBP2-56868PEP) (0)

There are no publications for ICA1 Recombinant Protein Antigen (NBP2-56868PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ICA1 Recombinant Protein Antigen (NBP2-56868PEP) (0)

There are no reviews for ICA1 Recombinant Protein Antigen (NBP2-56868PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ICA1 Recombinant Protein Antigen (NBP2-56868PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ICA1 Products

Research Areas for ICA1 Recombinant Protein Antigen (NBP2-56868PEP)

Find related products by research area.

Blogs on ICA1

There are no specific blogs for ICA1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ICA1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ICA1