![Immunohistochemistry-Paraffin: HPRT Antibody [NBP1-92006] - Analysis in human testis and skeletal muscle tissues. Corresponding HPRT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/HPRT-Antibody-Immunohistochemistry-Paraffin-NBP1-92006-img0015.jpg "Immunohistochemistry-Paraffin: HPRT Antibody [NBP1-92006] - Analysis in human testis and skeletal muscle tissues. Corresponding HPRT RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMV |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HPRT1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for HPRT Antibody (NBP1-92006)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: HPRT Antibody [NBP1-92006] - Analysis in human cell line HEK 293.](http://images.novusbio.com/fullsize/HPRT-Antibody-Western-Blot-NBP1-92006-img0007.jpg "Western Blot: HPRT Antibody [NBP1-92006] - Analysis in human cell line HEK 293.")
![Immunocytochemistry/Immunofluorescence: HPRT Antibody [NBP1-92006] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://images.novusbio.com/fullsize/HPRT-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92006-img0008.jpg "Immunocytochemistry/Immunofluorescence: HPRT Antibody [NBP1-92006] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.")
![Immunohistochemistry-Paraffin: HPRT Antibody [NBP1-92006] - Staining of human testis shows very strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/HPRT-Antibody-Immunohistochemistry-Paraffin-NBP1-92006-img0019.jpg "Immunohistochemistry-Paraffin: HPRT Antibody [NBP1-92006] - Staining of human testis shows very strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: HPRT Antibody [NBP1-92006] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/HPRT-Antibody-Immunohistochemistry-Paraffin-NBP1-92006-img0016.jpg "Immunohistochemistry-Paraffin: HPRT Antibody [NBP1-92006] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: HPRT Antibody [NBP1-92006] - Staining of human kidney shows strong cytoplasmic positivity in cells in distal tubules.](http://images.novusbio.com/fullsize/HPRT-Antibody-Immunohistochemistry-Paraffin-NBP1-92006-img0017.jpg "Immunohistochemistry-Paraffin: HPRT Antibody [NBP1-92006] - Staining of human kidney shows strong cytoplasmic positivity in cells in distal tubules.")
![Immunohistochemistry-Paraffin: HPRT Antibody [NBP1-92006] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/HPRT-Antibody-Immunohistochemistry-Paraffin-NBP1-92006-img0018.jpg "Immunohistochemistry-Paraffin: HPRT Antibody [NBP1-92006] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")