Novus Biologicals products are now on bio-techne.com

hnRNP H2 Recombinant Protein Antigen

Name: hnRNP H2 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-89816PEP
Price: 279 USD

Images

There are currently no images for hnRNP H2 Protein (NBP1-89816PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

100% Guarantee on every product

hnRNP H2 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HNRNPH2. Source: E. coli Amino Acid Sequence: FIYTREGRPSGEAFVELESEEEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFAS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	HNRNPH2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89816. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for hnRNP H2 Recombinant Protein Antigen

FTP-3
FTP3hnRNP H2
Heterogeneous nuclear ribonucleoprotein H'
heterogeneous nuclear ribonucleoprotein H2 (H')
heterogeneous nuclear ribonucleoprotein H2
hnRNP H'
hnRNPH'
HNRPH'
HNRPH2heterogeneous nuclear ribonucleoprotein H-prime

Background

The hnRNP H2 gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in th

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SHMT1 Antibody

NBP1-85437

Immunohistochemistry-Paraffin SHMT1 Antibody

(1 Review)

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

PD-ECGF/Thymidine
Phosphorylase Antibod ...

NB100-2737

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IP, WB

Cytokeratin 18
Antibody [Unconjugate

AF7619

Immunohistochemistry Cytokeratin 18 Antibody [Unconjugated]

Simple Western Cytokeratin 18 Antibody [Unconjugated]

(2 Publications)

Species: Hu

Applications: ICC, IHC, KO, Simple Western, WB

Dimethylarginine
Dimethylaminohydrolas ...

NBP1-85273

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

CUGBP1/CELF1
Antibody (3B1)

NB200-316

Flow Cytometry CUGBP1/CELF1 Antibody (3B1)

Simple Western CUGBP1/CELF1 Antibody (3B1)

(12 Publications)

Species: Bv, Hu, Mu, Po, Pm, Rb, Rt

Applications: Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

SHMT2 Antibody

NBP1-80755

Immunohistochemistry-Paraffin SHMT2 Antibody

(6 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Vitamin D BP
Antibody [Unconjugate

AF4188

Western Blot Vitamin D BP Antibody [Unconjugated]

(1 Publication)

Species: Mu

Applications: Simple Western, WB

alpha-Galactosidase A/ ...

6146-GH

SDS-PAGE alpha-Galactosidase A/GLA [Unconjugated]

(3 Publications)

Species: Hu

Applications: EnzAct

eEF1A1 Antibody -
Azide and BSA Free

NBP2-92880

Immunohistochemistry-Paraffin eEF1A1 Antibody - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

HSD17B4 Antibody

NBP1-85296

(1 Review)

(3 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

hnRNP K Antibody

NBP2-24531

Immunohistochemistry-Paraffin hnRNP K Antibody

(1 Review)

(1 Publication)

Species: Hu, Mu, Ma-Op, Pm, Rt

Applications: IHC, IHC-P, WB

PSMC3 Antibody
(OTI9F3)

NBP2-02316

Immunohistochemistry-Paraffin PSMC3 Antibody (OTI9F3)

Species: Ca, Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

CD34 Antibody (MEC
14.7)

NB600-1071

Immunocytochemistry/ Immunofluorescence CD34 Antibody (MEC 14.7)

(28 Publications)

Species: Hu(-), Mu

Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

BTK [p Tyr223]
Antibody - BSA Free

NBP1-78295

Western Blot BTK [p Tyr223] Antibody - BSA Free

(6 Publications)

Species: Hu, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

PABP Antibody
(10E10) - BSA Free

NB120-6125

Western Blot PABP Antibody (10E10) - BSA Free

(1 Review)

(11 Publications)

Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB

hnRNP K Antibody

NBP2-24531

(1 Review)

(1 Publication)

Species: Hu, Mu, Ma-Op, Pm, Rt

Applications: IHC, IHC-P, WB

hnRNP H Antibody

NB100-385

(1 Review)

(15 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB

Choline Kinase
beta [Unconjugated]

8184-CK

Species: Hu

Applications: EnzAct

HSP90 alpha
Antibody

NB120-2928

Immunohistochemistry-Paraffin HSP90 alpha Antibody

(11 Publications)

Species: Hu, Mu, Pm, Rb, Rt, Sh

Applications: ICC/IF, IHC, IHC-P, IP, WB

hnRNP H2
Recombinant Protein A

NBP1-89816PEP

Species: Hu

Applications: AC

Publications for hnRNP H2 Protein (NBP1-89816PEP) (0)

There are no publications for hnRNP H2 Protein (NBP1-89816PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hnRNP H2 Protein (NBP1-89816PEP) (0)

There are no reviews for hnRNP H2 Protein (NBP1-89816PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for hnRNP H2 Protein (NBP1-89816PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional hnRNP H2 Products

Blogs on hnRNP H2

There are no specific blogs for hnRNP H2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD34 was detected in perfusion fixed frozen sections of rat liver using 15 µg/mL Rat CD34 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4117) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.

CD34 Antibody [Unconjugated]
AF4117

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our hnRNP H2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

HNRNPH2

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

hnRNP H2 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

hnRNP H2 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for hnRNP H2 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for hnRNP H2 Protein (NBP1-89816PEP) (0)

Reviews for hnRNP H2 Protein (NBP1-89816PEP) (0)

FAQs for hnRNP H2 Protein (NBP1-89816PEP) (0)

Additional hnRNP H2 Products

Blogs on hnRNP H2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics