![Immunohistochemistry-Paraffin: Histidase Antibody [NBP1-89694] - Staining of human cerebral cortex, liver, skin and testis using Anti-HAL antibody NBP1-89694 (A) shows similar protein distribution across tissues to independent antibody NBP1-89695 (B).](http://images.novusbio.com/fullsize/Histidase-Antibody-Immunohistochemistry-Paraffin-NBP1-89694-img0007.jpg "Immunohistochemistry-Paraffin: Histidase Antibody [NBP1-89694] - Staining of human cerebral cortex, liver, skin and testis using Anti-HAL antibody NBP1-89694 (A) shows similar protein distribution across tissues to independent antibody NBP1-89695 (B).")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FVEVVIEGDAMSPDFIPSQPEGVYLYSKYREPEKYIELDGDRLTTEDLVNLGKGRYKIKLTPTAEKRVQKSREVIDSIIKEKTVVYGITTGFGKFARTV |
| Predicted Species | Mouse (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HAL |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HAL |
![Immunohistochemistry-Paraffin: Histidase Antibody [NBP1-89694] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/Histidase-Antibody-Immunohistochemistry-Paraffin-NBP1-89694-img0003.jpg "Immunohistochemistry-Paraffin: Histidase Antibody [NBP1-89694] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: Histidase Antibody [NBP1-89694] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/Histidase-Antibody-Immunohistochemistry-Paraffin-NBP1-89694-img0004.jpg "Immunohistochemistry-Paraffin: Histidase Antibody [NBP1-89694] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Histidase Antibody [NBP1-89694] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.](http://images.novusbio.com/fullsize/Histidase-Antibody-Immunohistochemistry-Paraffin-NBP1-89694-img0005.jpg "Immunohistochemistry-Paraffin: Histidase Antibody [NBP1-89694] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.")
![Immunohistochemistry-Paraffin: Histidase Antibody [NBP1-89694] - Staining of human testis shows moderate cytoplasmic positivity.](http://images.novusbio.com/fullsize/Histidase-Antibody-Immunohistochemistry-Paraffin-NBP1-89694-img0006.jpg "Immunohistochemistry-Paraffin: Histidase Antibody [NBP1-89694] - Staining of human testis shows moderate cytoplasmic positivity.")
![Enzyme Activity u-Plasminogen Activator/Urokinase [Unconjugated]](https://images.novusbio.com/images2/uPlasminogen_Activator_1310SE_1837.jpg)
![Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Immunocytochemistry_6560.jpg)
![Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Flow_Cytometry_20264.jpg)
![Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Immunocytochemistry__Immunofluorescence_19196.jpg)
![Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Flow_Cytometry_19476.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")