Home » HIC1 » HIC1 Proteins » HIC1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

HIC1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HIC1 Protein (NBP1-80607PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HIC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HIC1.

Source: E. coli

Amino Acid Sequence: ELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDGRTIDRFSPT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HIC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80607.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HIC1 Recombinant Protein Antigen

  • hic-1
  • hypermethylated in cancer 1
  • ZBTB29hypermethylated in cancer 1 protein
  • Zinc finger and BTB domain-containing protein 29
  • ZNF901

Background

Transcriptional repressor. May act as a tumor suppressor. May be involved in development of head, face, limbsand ventral body wall

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
RASSF1 Antibody
(OTI2B11)
NBP2-03644
Flow Cytometry RASSF1 Antibody (OTI2B11)
Western Blot RASSF1 Antibody (OTI2B11)
Immunohistochemistry-Paraffin RASSF1 Antibody (OTI2B11)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Sirtuin 1/SIRT1
Antibody (1F3) - BSA ...
NBP1-51641
Immunohistochemistry-Paraffin Sirtuin 1/SIRT1 Antibody (1F3) - BSA Free
Flow Cytometry Sirtuin 1/SIRT1 Antibody (1F3) - BSA Free
Immunocytochemistry/ Immunofluorescence Sirtuin 1/SIRT1 Antibody (1F3) - BSA Free
(9 Publications)
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
MGMT Antibody (MT
23.2) - BSA Free
NB100-168
Flow (Intracellular) MGMT Antibody (MT 23.2) - BSA Free
Flow Cytometry MGMT Antibody (MT 23.2) - BSA Free
Flow (Intracellular) MGMT Antibody (MT 23.2) - BSA Free
(21 Publications)
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
p15INK4b/CDKN2B
Antibody (OTI3B6)
NBP2-45603
Flow Cytometry p15INK4b/CDKN2B Antibody (OTI3B6)
Immunohistochemistry p15INK4b/CDKN2B Antibody (OTI3B6)
Immunohistochemistry p15INK4b/CDKN2B Antibody (OTI3B6)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
E-Cadherin
Antibody [Unconjugate
AF748
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
Immunohistochemistry E-Cadherin Antibody [Unconjugated]
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
(139 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
SUB1 Antibody
NBP1-82454
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/ Immunofluorescence APC Antibody - BSA Free
Flow Cytometry APC Antibody - BSA Free
Immunohistochemistry-Paraffin APC Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MLH1 Antibody
(SP08-04)
NBP2-67381
Flow Cytometry MLH1 Antibody (SP08-04)
Immunocytochemistry/ Immunofluorescence MLH1 Antibody (SP08-04)
Immunohistochemistry-Paraffin MLH1 Antibody (SP08-04)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Coagulation Factor
XIV/Protein C Antibod ...
AF4885
Coagulation Factor XIV/Protein C Antibody
(2 Publications)
Species: Mu
Applications: IP, WB
FZR1/CDH1 Antibody
NBP2-15840
Western Blot FZR1/CDH1 Antibody
Immunocytochemistry/ Immunofluorescence FZR1/CDH1 Antibody
Immunohistochemistry-Paraffin FZR1/CDH1 Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DAP Kinase 1
Antibody (SR1225)
NBP3-21649
Immunohistochemistry DAP Kinase 1 Antibody (SR1225)
Western Blot DAP Kinase 1 Antibody (SR1225)
Immunocytochemistry/ Immunofluorescence DAP Kinase 1 Antibody (SR1225)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Glutathione
S-Transferase pi 1/GS ...
NBP2-16756
Western Blot Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunocytochemistry/ Immunofluorescence Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunohistochemistry-Paraffin Glutathione S-Transferase pi 1/GSTP1 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(10 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NXT1 Antibody
(4F11)
H00029107-M08
Western Blot NXT1 Antibody (4F11)
Immunocytochemistry/ Immunofluorescence NXT1 Antibody (4F11)
Western Blot NXT1 Antibody (4F11)
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
RUNX3/CBFA3
Antibody (527327) [Un ...
MAB3765
Immunocytochemistry RUNX3/CBFA3 Antibody (527327) [Unconjugated]
Western Blot RUNX3/CBFA3 Antibody (527327) [Unconjugated]
Simple Western RUNX3/CBFA3 Antibody (527327) [Unconjugated]
(6 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, Simple Western, WB
MRPL28 Antibody
(3B9F2)
NBP3-15267
Immunocytochemistry/ Immunofluorescence MRPL28 Antibody (3B9F2)
Immunocytochemistry/ Immunofluorescence MRPL28 Antibody (3B9F2)
Immunoprecipitation MRPL28 Antibody (3B9F2)
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
SOCS-1 Antibody
NB100-56637
Western Blot SOCS-1 Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: WB
IGF-II/IGF2
[Unconjugated]
292-G2
SDS-PAGE IGF-II/IGF2 [Unconjugated]
Bioactivity IGF-II/IGF2 [Unconjugated]
(47 Publications)
Species: Hu
Applications: BA

Publications for HIC1 Protein (NBP1-80607PEP) (0)

There are no publications for HIC1 Protein (NBP1-80607PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIC1 Protein (NBP1-80607PEP) (0)

There are no reviews for HIC1 Protein (NBP1-80607PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HIC1 Protein (NBP1-80607PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HIC1 Products

Array NBP1-80607PEP

Research Areas for HIC1 Protein (NBP1-80607PEP)

Find related products by research area.

Blogs on HIC1

There are no specific blogs for HIC1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HIC1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HIC1