![Western Blot: HES-1 Antibody (9I2E8) [NBP3-15320] - Western blot analysis of extracts of various cell lines, using HES-1 Rabbit mAb (NBP3-15320) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/HES-1-Antibody-9I2E8-Western-Blot-NBP3-15320-img0003.jpg "Western Blot: HES-1 Antibody (9I2E8) [NBP3-15320] - Western blot analysis of extracts of various cell lines, using HES-1 Rabbit mAb (NBP3-15320) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.")
| Reactivity | Mu, RtSpecies Glossary |
| Applications | WB, IHC, IP |
| Clone | 9I2E8 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 181-280 of human HES-1 (Q14469). FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | HES1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for HES-1 Antibody (NBP3-15320)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HES1 |
![Immunohistochemistry-Paraffin: HES-1 Antibody (9I2E8) [NBP3-15320] - Immunohistochemistry of paraffin-embedded mouse spinal cord using HES-1 Rabbit mAb (NBP3-15320) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/HES-1-Antibody-9I2E8-Immunohistochemistry-Paraffin-NBP3-15320-img0002.jpg "Immunohistochemistry-Paraffin: HES-1 Antibody (9I2E8) [NBP3-15320] - Immunohistochemistry of paraffin-embedded mouse spinal cord using HES-1 Rabbit mAb (NBP3-15320) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: HES-1 Antibody (9I2E8) [NBP3-15320] - Immunohistochemistry of paraffin-embedded rat brain using HES-1 Rabbit mAb (NBP3-15320) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/HES-1-Antibody-9I2E8-Immunohistochemistry-Paraffin-NBP3-15320-img0001.jpg "Immunohistochemistry-Paraffin: HES-1 Antibody (9I2E8) [NBP3-15320] - Immunohistochemistry of paraffin-embedded rat brain using HES-1 Rabbit mAb (NBP3-15320) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunoprecipitation: HES-1 Antibody (9I2E8) [NBP3-15320] - Immunoprecipitation analysis of 600ug extracts of Rat testis cells using 3ug HES-1 antibody (NBP3-15320). Western blot was performed from the immunoprecipitate using HES-1 antibody (NBP3-15320) at a dilition of 1:500.](http://images.novusbio.com/fullsize/HES-1-Antibody-9I2E8-Immunoprecipitation-NBP3-15320-img0004.jpg "Immunoprecipitation: HES-1 Antibody (9I2E8) [NBP3-15320] - Immunoprecipitation analysis of 600ug extracts of Rat testis cells using 3ug HES-1 antibody (NBP3-15320). Western blot was performed from the immunoprecipitate using HES-1 antibody (NBP3-15320) at a dilition of 1:500.")
![Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunohistochemistry_21186.jpg)
![Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Western_Blot_11656.jpg)
![Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunocytochemistry_11911.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunohistochemistry ASCL1/Mash1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2567_mouse-ascl1-mash1-affinity-purified-polyclonal-ab-immunohistochemistry-1732021122114.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Immunocytochemistry Notch-4 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3847_human-notch-4-intracellular-domain-affinity-purified-pab-immunocytochemistry-3092021102949.jpg)
![Western Blot SGPL1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SGPL1_AF5535_Western_Blot_5750.jpg)
![Simple Western SGPL1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SGPL1_AF5535_Simple_Western_17128.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")