Home » Hemogen » Hemogen Proteins » Hemogen Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Hemogen Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Hemogen Protein (NBP1-84908PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Hemogen Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HEMGN.

Source: E. coli

Amino Acid Sequence: VISVIQDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAEPEEYNETDQGI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HEMGN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84908.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Hemogen Recombinant Protein Antigen

  • EDAGEDAG-1
  • Erythroid differentiation-associated gene protein
  • hemogen
  • Hemopoietic gene protein
  • NDR
  • Negative differentiation regulator protein

Background

Regulates the proliferation and differentiation of hematopoietic cells. Overexpression block the TPA-induced megakaryocytic differentiation in the K562 cell model. May also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

STK38 Antibody
(2G8-1F3)
H00011329-M01
Immunohistochemistry-Paraffin STK38 Antibody (2G8-1F3)
Immunocytochemistry/ Immunofluorescence STK38 Antibody (2G8-1F3)
Immunohistochemistry-Paraffin STK38 Antibody (2G8-1F3)
(1 Publication)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Sphingomyelin
synthase 1 Antibody
NBP1-92435
Immunohistochemistry-Paraffin Sphingomyelin synthase 1 Antibody
Immunohistochemistry-Paraffin Sphingomyelin synthase 1 Antibody
Immunohistochemistry-Paraffin Sphingomyelin synthase 1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
STK38L Antibody
(OTI4D8)
NBP2-45983
Immunocytochemistry/ Immunofluorescence STK38L Antibody (OTI4D8)
Immunohistochemistry STK38L Antibody (OTI4D8)
Immunohistochemistry STK38L Antibody (OTI4D8)
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NDRG1 Antibody
NBP1-86636
Western Blot NDRG1 Antibody
Immunohistochemistry-Paraffin NDRG1 Antibody
Immunohistochemistry-Paraffin NDRG1 Antibody
(5 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MOBKL1B Antibody
(2D3D11) - BSA Free
NBP2-61873
ELISA MOBKL1B Antibody (2D3D11) - BSA Free
Flow Cytometry MOBKL1B Antibody (2D3D11) - BSA Free
Western Blot MOBKL1B Antibody (2D3D11) - BSA Free
Species: Hu
Applications: ELISA, Flow, WB
S100B Antibody
NBP1-87102
Immunocytochemistry/ Immunofluorescence S100B Antibody
Immunohistochemistry-Paraffin S100B Antibody
Immunohistochemistry-Paraffin S100B Antibody
(14 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MOB4A Antibody
(OTI3G9)
NBP2-02715
Western Blot MOB4A Antibody (OTI3G9)
Immunohistochemistry-Paraffin MOB4A Antibody (OTI3G9)
Immunohistochemistry-Paraffin MOB4A Antibody (OTI3G9)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
GATA-1 Antibody
(4F5) - BSA Free
NBP1-47492
Immunohistochemistry GATA-1 Antibody (4F5) - BSA Free
Immunocytochemistry/ Immunofluorescence GATA-1 Antibody (4F5) - BSA Free
Immunohistochemistry-Paraffin GATA-1 Antibody (4F5) - BSA Free
(1 Review)
(2 Publications)
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MST1/STK4 Antibody
(1D7-8A10)
H00006789-M01
ELISA MST1/STK4 Antibody (1D7-8A10)
Immunocytochemistry/ Immunofluorescence MST1/STK4 Antibody (1D7-8A10)
Immunohistochemistry-Paraffin MST1/STK4 Antibody (1D7-8A10)
(2 Publications)
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
MOBKL3 Antibody -
Azide and BSA Free
NBP3-03372
Immunohistochemistry-Paraffin MOBKL3 Antibody - Azide and BSA Free
Western Blot MOBKL3 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin MOBKL3 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
LATS1 Antibody
NB200-197
Western Blot LATS1 Antibody
Western Blot LATS1 Antibody
(6 Publications)
Species: Hu, Mu
Applications: IP, WB
SDPR Antibody
AF5759
Western Blot SDPR Antibody
(6 Publications)
Species: Hu, Mu
Applications: WB
HCCA2 Antibody
NBP1-91978
Immunocytochemistry/ Immunofluorescence HCCA2 Antibody
Immunohistochemistry-Paraffin HCCA2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PMEL17/SILV
Antibody (HMB45)
NBP2-44520
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Immunohistochemistry PMEL17/SILV Antibody (HMB45)
(8 Publications)
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
MST3 Antibody
NBP1-87833
Western Blot MST3 Antibody
Immunocytochemistry/ Immunofluorescence MST3 Antibody
Immunohistochemistry-Paraffin MST3 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ACE-2 Antibody
[Unconjugated]
AF933
Simple Western ACE-2 Antibody [Unconjugated]
Immunohistochemistry ACE-2 Antibody [Unconjugated]
Immunohistochemistry ACE-2 Antibody [Unconjugated]
(1 Review)
(294 Publications)
Species: Ha, Hu, Mu, Rt
Applications: Block, Flow, IHC, IP, Simple Western, WB
MSP/MST1
[Unconjugated]
352-MS
MSP/MST1 [Unconjugated]
(9 Publications)
Species: Hu
Applications: BA, BA
IL-3 [Unconjugated]
203-IL
SDS-PAGE IL-3 [Unconjugated]
Bioactivity IL-3 [Unconjugated]
SEC-MALS IL-3 [Unconjugated]
(217 Publications)
Species: Hu
Applications: BA

Publications for Hemogen Protein (NBP1-84908PEP) (0)

There are no publications for Hemogen Protein (NBP1-84908PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hemogen Protein (NBP1-84908PEP) (0)

There are no reviews for Hemogen Protein (NBP1-84908PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Hemogen Protein (NBP1-84908PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hemogen Products

Blogs on Hemogen

There are no specific blogs for Hemogen, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Simple Western lane view shows lysates of human kidney tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE‑2 at approximately 155 kDa (as indicated) using 10 µg/mL of Goat Anti-Human ACE‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF933) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
ACE-2 Antibody [Unconjugated]
AF933

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Hemogen Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HEMGN