HAND1 Antibody Summary
Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein HAND1 using the following amino acid sequence: HPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFP |
Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
HAND1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
|
Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for HAND1 Antibody
Background
HAND1 is encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, it has been suggested that this transcription factor may be required for early trophoblast differentiation. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Bv, Eq, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, KD, KO, Simple Western, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ICC/IF, IHC
Species: Hu
Applications: ICC, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for HAND1 Antibody (NBP3-24890) (0)
There are no publications for HAND1 Antibody (NBP3-24890).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HAND1 Antibody (NBP3-24890) (0)
There are no reviews for HAND1 Antibody (NBP3-24890).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HAND1 Antibody (NBP3-24890) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HAND1 Products
Research Areas for HAND1 Antibody (NBP3-24890)
Find related products by research area.
|
Blogs on HAND1