GLP-1R Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Mouse GLP-1R (NP_067307). Peptide sequence YRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLYIIYTV |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GLP1R |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
51 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for GLP-1R Antibody
Background
GLP1R, a Glucagon Receptor, has been suggested to affect the feelings of satiety or hunger, sensation of glucose levels, control of glucagon sensitivity of islets, and non insulin-dependent diabetes mellitus. Glucagon-like peptide 1 is an incretin hormone produced by enteroendocrine L-cells in the intestinal mucosa. The hormone is released in response to food intake and plays an important role in maintaining blood glucose homeostasis. Stimulation of the GLP-1R by endogenous hormone induces multiple complementary mechanisms, which together result in a lowering of circulating blood glucose levels. These mechanisms include receptor-mediated enhancement of glucose-induced insulin secretion from pancreatic -cells, inhibition of gastric emptying with a delay in the gastrointestinal resorption of nutrients, inhibition of glucagon secretion, and inhibition of food intake. Desensitization of GLP1R on pancreatic beta-cells is one of the causes of non insulin-dependent diabetes mellitus (NIDDM). GLP1R knockout mice are viable, develop normally, but exhibit increased levels of blood glucose following oral glucose challenge in association with diminished levels of circulating insulin. Recently it has been shown that overexpression of glucagon-like peptide-1 receptor improves learning in rats (During et al. 2003). GLP1R has been reported in pancreas, brain, heart, kidney, lung, and stomach. ESTs have been isolated from kidney and skin libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: IHC
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Eq, Ha, Hu, Pm, Pm
Applications: IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Mu
Applications: WB
Publications for GLP-1R Antibody (NBP3-09432) (0)
There are no publications for GLP-1R Antibody (NBP3-09432).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GLP-1R Antibody (NBP3-09432) (0)
There are no reviews for GLP-1R Antibody (NBP3-09432).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GLP-1R Antibody (NBP3-09432) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GLP-1R Products
Research Areas for GLP-1R Antibody (NBP3-09432)
Find related products by research area.
|
Blogs on GLP-1R