Home » GEN1 » GEN1 Proteins » GEN1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

GEN1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for GEN1 Protein (NBP2-30836PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

GEN1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GEN1.

Source: E. coli

Amino Acid Sequence: LAIQQIKAVSKSLISESSQPNTSSHNISVIADLHLSTIDWEGTSFSNSPAIQRNTFSHDLKSEVESELSAIPDGFENIPEQLSCESERYTANIKKVLDEDSDGISPEEHLLSGITDLCLQDLPLKERIFIKLSYPQDNLQPDVNLKT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GEN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30836.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GEN1 Recombinant Protein Antigen

  • DKFZp781F0986
  • EC 3.1
  • flap endonuclease GEN homolog 1
  • FLJ40869
  • Gen homolog 1, endonuclease (Drosophila)
  • Gen

Background

Endonuclease which cleaves flap structures at the junction between single-stranded DNA and double-strandedDNA. Specific for 5'-overhanging flap structures in which the 5'-upstream of the flap is completely double-stranded.Prefers the blocked-flap structures similar to those occurring at replication forks, in which the 5' single-strandoverhang of the flap is double-stranded

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ZBTB8OS Antibody
NBP2-30455
Immunohistochemistry ZBTB8OS Antibody
Immunocytochemistry/ Immunofluorescence ZBTB8OS Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P

COMP/Thrombospondin-5
DCMP0
N/A COMP/Thrombospondin-5 [HRP]
N/A COMP/Thrombospondin-5 [HRP]
(11 Publications)
Species: Hu
Applications: ELISA
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
IRF1 Antibody
AF4715
Western Blot IRF1 Antibody
(1 Review)
(2 Publications)
Species: Mu
Applications: WB
Neprilysin-2/MMEL1
Antibody
AF2340
Neprilysin-2/MMEL1 Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
Plexin B1 Antibody
[Unconjugated]
AF3749
Plexin B1 Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: IHC, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
Muscleblind-like 1
Antibody (3E7)
H00004154-M02
Western Blot Muscleblind-like 1 Antibody (3E7)
ELISA Muscleblind-like 1 Antibody (3E7)
Immunocytochemistry/ Immunofluorescence Muscleblind-like 1 Antibody (3E7)
(3 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DBT Antibody
NBP1-89522
Immunocytochemistry/ Immunofluorescence DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
(6 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Rpn2 Antibody
NBP2-38323
Immunocytochemistry/ Immunofluorescence Rpn2 Antibody
Immunohistochemistry-Paraffin Rpn2 Antibody
Immunohistochemistry-Paraffin Rpn2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(10 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Actin Antibody
(mAbGEa)
NB100-74340
Immunocytochemistry/ Immunofluorescence Actin Antibody (mAbGEa)
Western Blot Actin Antibody (mAbGEa)
Immunocytochemistry/ Immunofluorescence Actin Antibody (mAbGEa)
(8 Reviews)
(33 Publications)
Species: Bv, ChHa, Dr, Fu, Hu, Mu, Pl, Pr, Rb, Rt, Sh, Xp, Ye, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
gamma-Synuclein
Antibody
NBP1-89996
Western Blot gamma-Synuclein Antibody
Immunohistochemistry-Paraffin gamma-Synuclein Antibody
Immunohistochemistry gamma-Synuclein Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Secretin R Antibody
NBP1-86125
Immunohistochemistry-Paraffin Secretin R Antibody
Immunohistochemistry-Paraffin Secretin R Antibody
Immunohistochemistry-Paraffin Secretin R Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Kv11.1 Antibody -
Azide and BSA Free
NBP3-03109
Immunohistochemistry-Paraffin Kv11.1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Kv11.1 Antibody - Azide and BSA Free
Western Blot Kv11.1 Antibody - Azide and BSA Free
Species: Hu, Mu
Applications: IHC, IHC-P, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
GEN1 Recombinant
Protein Antigen
NBP2-30836PEP
GEN1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for GEN1 Protein (NBP2-30836PEP) (0)

There are no publications for GEN1 Protein (NBP2-30836PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GEN1 Protein (NBP2-30836PEP) (0)

There are no reviews for GEN1 Protein (NBP2-30836PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GEN1 Protein (NBP2-30836PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GEN1 Products

Research Areas for GEN1 Protein (NBP2-30836PEP)

Find related products by research area.

Blogs on GEN1

There are no specific blogs for GEN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: iNOS Antibody [NB300-605] - Analysis of iNOS was performed by loading 20 ug of RAW264 whole cell lysate untreated (left lane) or stimulated with LPS at 1 ug/mL for 16 hours (right lane) and 10 uL of PageRuler Plus Prestained Protein Ladder onto a 4-20% Tris-Glycine polyacrylamide gel. Proteins were transferred to a nitrocellulose membrane and blocked with 5% Milk in TBST for at least 1 hour. The membrane was probed with an iNOS Rabbit polyclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBST, and probed with a Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP conjugate at a dilution of 1:1000 for 1 hour. Chemiluminescent detection was performed using SuperSignal West Pico.
iNOS Antibody - BSA Free
NB300-605
Immunocytochemistry/Immunofluorescence: Actin Antibody (mAbGEa) [NB100-74340] - NIH-3T3 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-Actin (mAbGEa) at 5 ug/mL overnight at 4C and detected with an anti-Mouse IgM DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Actin Antibody (mAbGEa)
NB100-74340

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GEN1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GEN1