Geminin Antibody - BSA Free Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWK |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GMNN |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Geminin Antibody - BSA Free
Background
Geminin is a multifunctional nuclear protein invloved in embyro development/differentiation, cell cycle regulation and DNA replciation. Originally defined as an inhibitor of DNA replication and substrate of the anaphase promoting complex, Geminin has also been shown to expand the neural plate in the developing embryos.
Geminin prevents DNA replication by blocking the MCM complex incorporation into prereplication complex (pre-RC). It is absent during the G1 phase and accumulates during the S, G2, and M phases of mitosis. Geminin is then degraded during the metaphase-anaphase trasitio,n allowing replication to occur during subsequent cycles.
Geminin antibodies are useful tools for a variety of research including developmental embryology, stem cell differentiation, neuroscience, and DNA replication studies.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
Species: Mu
Applications: KO, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: IP (-), WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Mu
Applications: IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF
Publications for Geminin Antibody (NBP2-56766) (0)
There are no publications for Geminin Antibody (NBP2-56766).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Geminin Antibody (NBP2-56766) (0)
There are no reviews for Geminin Antibody (NBP2-56766).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Geminin Antibody (NBP2-56766) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Geminin Products
Research Areas for Geminin Antibody (NBP2-56766)
Find related products by research area.
|
Blogs on Geminin