Home » GADD45 alpha » GADD45 alpha Antibodies » GADD45 alpha Antibody
Novus Biologicals products are now on bio-techne.com

GADD45 alpha Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: GADD45 alpha Antibody [NBP2-55059] - Staining of human cell line PC-3 shows localization to nuclear speckles.
Immunocytochemistry/ Immunofluorescence: GADD45 alpha Antibody [NBP2-55059] - Staining of human cell line PC-3 shows localization to nuclear speckles.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

GADD45 alpha Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQ
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GADD45A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GADD45 alpha Recombinant Protein Antigen (NBP2-55059PEP)

Reactivity Notes

Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GADD45 alpha Antibody

  • DDIT-1
  • DDIT1growth arrest and DNA damage-inducible protein GADD45 alpha
  • DNA damage-inducible transcript 1 protein
  • DNA damage-inducible transcript-1
  • GADD45 alpha
  • GADD45a
  • GADD45DNA-damage-inducible transcript 1
  • growth arrest and DNA-damage-inducible 45 alpha
  • growth arrest and DNA-damage-inducible, alpha

Background

GADD45A is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Species: Hu
Applications: IHC, IHC-P, WB
D4S234E Antibody
(1C3)
H00027065-M01
Sandwich ELISA D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
PAK3 Antibody
[Unconjugated]
AF6897
Western Blot PAK3 Antibody [Unconjugated]
Immunohistochemistry PAK3 Antibody [Unconjugated]
Immunohistochemistry PAK3 Antibody [Unconjugated]
Species: Hu, Mu
Applications: IHC, Simple Western, WB
MYD118 Antibody
NBP3-12326
Western Blot MYD118 Antibody
Immunohistochemistry-Paraffin MYD118 Antibody
Immunohistochemistry-Paraffin MYD118 Antibody
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
GADD153/CHOP
Antibody (9C8)
NB600-1335
Western Blot GADD153/CHOP Antibody (9C8)
Flow Cytometry GADD153/CHOP Antibody (9C8)
Immunohistochemistry-Paraffin GADD153/CHOP Antibody (9C8)
(3 Reviews)
(46 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/ Immunofluorescence PCNA Antibody (PC10)
Western Blot PCNA Antibody (PC10)
Flow Cytometry PCNA Antibody (PC10)
(5 Reviews)
(46 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
SLC12A9 Antibody
NBP2-68858
Immunohistochemistry-Paraffin SLC12A9 Antibody
Species: Hu
Applications: IHC, IHC-P
MDM2/HDM2 Antibody
(SMP14) - BSA Free
NB100-2736
Western Blot MDM2/HDM2 Antibody (SMP14) - BSA Free
Immunohistochemistry-Paraffin MDM2/HDM2 Antibody (SMP14) - BSA Free
Immunohistochemistry-Paraffin MDM2/HDM2 Antibody (SMP14) - BSA Free
(1 Review)
(22 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Bcl-2 Antibody
NB100-56098
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
(2 Reviews)
(26 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
GADD45G Antibody
(OTI2F12)
NBP2-45807
Immunocytochemistry/ Immunofluorescence GADD45G Antibody (OTI2F12)
Immunohistochemistry GADD45G Antibody (OTI2F12)
Immunohistochemistry GADD45G Antibody (OTI2F12)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Bax Antibody (6A7)
NBP1-28566
Western Blot Bax Antibody (6A7)
Western Blot Bax Antibody (6A7)
Immunohistochemistry-Frozen Bax Antibody (6A7)
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(389 Publications)
Species: Hu, Mu
Applications: ICC, IHC
CDC2/CDK1 Antibody
NBP1-85729
Immunohistochemistry-Paraffin CDC2/CDK1 Antibody
Western Blot CDC2/CDK1 Antibody
Western Blot CDC2/CDK1 Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western p38 alpha Antibody [Unconjugated]
Western Blot p38 alpha Antibody [Unconjugated]
Immunohistochemistry p38 alpha Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
GADD45 alpha
Antibody
NBP2-55059
GADD45 alpha Antibody
Species: Hu, Mu
Applications: ICC/IF

Publications for GADD45 alpha Antibody (NBP2-55059) (0)

There are no publications for GADD45 alpha Antibody (NBP2-55059).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GADD45 alpha Antibody (NBP2-55059) (0)

There are no reviews for GADD45 alpha Antibody (NBP2-55059). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GADD45 alpha Antibody (NBP2-55059) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GADD45 alpha Products

Research Areas for GADD45 alpha Antibody (NBP2-55059)

Find related products by research area.

Blogs on GADD45 alpha

There are no specific blogs for GADD45 alpha, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GADD45 alpha Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol GADD45A