![Western Blot: FUS Antibody [NBP3-03651] - Analysis of extracts of various cell lines, using FUS antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.](http://images.novusbio.com/fullsize/FUS-Antibody-Western-Blot-NBP3-03651-img0008.jpg "Western Blot: FUS Antibody [NBP3-03651] - Analysis of extracts of various cell lines, using FUS antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IP, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 297-526 of human FUS (NP_004951.1). TIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FUS |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 53 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for FUS Antibody (NBP3-03651)Find related products by research area.
|
|
Transportin 1 and heterogeneous nuclear ribonucleoprotein D (hnRNPD) Transportin 1, also known as Karyopherin- beta 2 or Importin- beta 2, is part of the beta -karyopherins family, which consists of importins and exportins responsible for the active transport of proteins between the nucleus and cytoplasm. Transportin 1 is co... Read full blog post. |
|
Amyotrophic Lateral Sclerosis Infographic Amyotrophic lateral sclerosis is a neurological disease which impacts motor neurons that are involved in muscle movement throughout the body. The progressive degeneration of neurons causes weakened muscles and can lead to paralysis. There is no cure f... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FUS |
![Immunocytochemistry/Immunofluorescence: FUS Antibody [NBP3-03651] - Analysis of NIH/3T3 cells using FUS antibody at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/FUS-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03651-img0002.jpg "Immunocytochemistry/Immunofluorescence: FUS Antibody [NBP3-03651] - Analysis of NIH/3T3 cells using FUS antibody at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: FUS Antibody [NBP3-03651] - Mouse spleen using FUS antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/FUS-Antibody-Immunohistochemistry-Paraffin-NBP3-03651-img0006.jpg "Immunohistochemistry-Paraffin: FUS Antibody [NBP3-03651] - Mouse spleen using FUS antibody at dilution of 1:100 (40x lens).")
![Immunocytochemistry/Immunofluorescence: FUS Antibody [NBP3-03651] - Analysis of C6 cells using FUS antibody at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/FUS-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03651-img0001.jpg "Immunocytochemistry/Immunofluorescence: FUS Antibody [NBP3-03651] - Analysis of C6 cells using FUS antibody at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: FUS Antibody [NBP3-03651] - Human breast cancer using FUS antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/FUS-Antibody-Immunohistochemistry-Paraffin-NBP3-03651-img0003.jpg "Immunohistochemistry-Paraffin: FUS Antibody [NBP3-03651] - Human breast cancer using FUS antibody at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: FUS Antibody [NBP3-03651] - Rat brain using FUS antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/FUS-Antibody-Immunohistochemistry-Paraffin-NBP3-03651-img0004.jpg "Immunohistochemistry-Paraffin: FUS Antibody [NBP3-03651] - Rat brain using FUS antibody at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: FUS Antibody [NBP3-03651] - Mouse brain using FUS antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/FUS-Antibody-Immunohistochemistry-Paraffin-NBP3-03651-img0005.jpg "Immunohistochemistry-Paraffin: FUS Antibody [NBP3-03651] - Mouse brain using FUS antibody at dilution of 1:100 (40x lens).")
![Knockout Validated: FUS Antibody [NBP3-03651] - Analysis of extracts from normal (control) and FUS knockout (KO) 293T cells, using FUS antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.](http://images.novusbio.com/fullsize/FUS-Antibody-Knockout-Validated-NBP3-03651-img0007.jpg "Knockout Validated: FUS Antibody [NBP3-03651] - Analysis of extracts from normal (control) and FUS knockout (KO) 293T cells, using FUS antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.")
![Immunoprecipitation: FUS Antibody [NBP3-03651] - Analysis of 300ug extracts of Jurkat cells using 3ug FUS antibody. Western blot was performed from the immunoprecipitate using FUS antibody at a dilition of 1:2000.](http://images.novusbio.com/fullsize/FUS-Antibody-Immunoprecipitation-NBP3-03651-img0009.jpg "Immunoprecipitation: FUS Antibody [NBP3-03651] - Analysis of 300ug extracts of Jurkat cells using 3ug FUS antibody. Western blot was performed from the immunoprecipitate using FUS antibody at a dilition of 1:2000.")
![Western Blot ALS Antibody [Unconjugated]](https://images.novusbio.com/images2/ALS_AF1436_Western_Blot_17079.jpg)
![Western Blot S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Western_Blot_17324.jpg)
![Immunohistochemistry S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Immunohistochemistry_17440.jpg)
![Simple Western S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Simple_Western_18705.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")