| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FOXO1. Source: E. coli Amino Acid Sequence: LTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDM Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | FOXO1 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84674. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW | 34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Immunohistochemistry-Paraffin FOXO4 [p Ser197] Antibody - Azide and BSA Free](https://images.novusbio.com/images/FOXO4-[p-Ser197]-Antibody-Immunohistochemistry-Paraffin-NBP3-05393-img0001.jpg)
![Immunocytochemistry/ Immunofluorescence FOXO4 [p Ser197] Antibody - Azide and BSA Free](https://images.novusbio.com/images/FOXO4-[p-Ser197]-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-05393-img0002.jpg)
![Western Blot FOXO4 [p Ser197] Antibody - Azide and BSA Free](https://images.novusbio.com/images/FOXO4-[p-Ser197]-Antibody-Western-Blot-NBP3-05393-img0003.jpg)
![Western Blot PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/PTEN_AF847_Western_Blot_5922.jpg)
![Simple Western PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/16342.jpg)
![Knockout Validated PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/PTEN_AF847_Knockout_Validated_22996.jpg)
Research Areas for FoxO1/FKHR Protein (NBP1-84674PEP)Find related products by research area.
|
|
FOXO1/FKHR (fork head in Rhabdomyosarcoma) FOXO1 belongs to the very large Forkhead family of transcription factors which contain a conserved distinct DNA-binding domain known as the Forkhead Box, or FOX. The Forkhead domain is a 100 amino acid long motif capable of binding and bending DNA,... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FOXO1 |
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunocytochemistry Pax3/Pax7 Antibody (274212) [Unconjugated]](https://images.novusbio.com/images2/Pax3_MAB2457_Immunocytochemistry__Immunofluorescence_20313.jpg)
![Immunocytochemistry/ Immunofluorescence Pax3/Pax7 Antibody (274212) [Unconjugated]](https://images.novusbio.com/images/mab2457_human-mouse-pax3-pax7-mab-clone-274212-41202412512639.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Immunocytochemistry Pax7 Antibody (PAX7) [Unconjugated]](https://images.novusbio.com/images2/Pax7_MAB1675_Immunocytochemistry_6571.jpg)
![Immunocytochemistry Pax7 Antibody (PAX7) [Unconjugated]](https://images.novusbio.com/images2/Pax7_MAB1675_Immunocytochemistry__Immunofluorescence_20311.jpg)
![Immunohistochemistry Pax7 Antibody (PAX7) [Unconjugated]](https://images.novusbio.com/images2/mab1675_human-mouse-rat-chicken-pax7-mab-clone-pax7-immunohistochemistry-3082021134114.jpg)
![Western Blot p27/Kip1 [p Thr198] Antibody [Unconjugated]](https://images.novusbio.com/images2/p27_AF3994_Western_Blot_5374.jpg)
![N/A IGFBP-1 [Biotin]](https://images.novusbio.com/images2/DATA_IGFBP1_DY871_ELISA_2250.jpg)
![Insulin R/CD220 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Insulin R/CD220 [Unconjugated]")
![Flow Cytometry: FoxO1/FKHR Antibody (83N7F8) [NBP2-31376] - Using the Alexa Fluor 488 direct conjugate An intracellular stain was performed on Daudi cells with FoxO1/FKHR (83N7F8) antibody NBP2-31376AF488 (blue) and a matched isotype control NBP2-27231AF488 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.](https://images.novusbio.com/images/FoxO1-FKHR-Antibody-83N7F8-Flow-Cytometry-NBP2-31376-img0014.jpg "Flow Cytometry: FoxO1/FKHR Antibody (83N7F8) [NBP2-31376] - Using the Alexa Fluor 488 direct conjugate An intracellular stain was performed on Daudi cells with FoxO1/FKHR (83N7F8) antibody NBP2-31376AF488 (blue) and a matched isotype control NBP2-27231AF488 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.")