Home » FoxJ1/HFH4 » FoxJ1 Peptides and Proteins » Recombinant Human FoxJ1/HFH4 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human FoxJ1/HFH4 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human FoxJ1/HFH4 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-421 of Human FOXJ1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAESWLRLSGAGPAEEAGPEGGLEEPDALDDSLTSLQWLQEFSILNAKAPALPPGGTDPHGYHQVPGSAAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKGNFDWEAIFDAGTLGGELGALEALELSPPLSPASHVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
FOXJ1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
71.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FoxJ1/HFH4 GST (N-Term) Protein

  • FKHL13
  • FKHL13forkhead transcription factor HFH-4
  • forkhead box J1
  • forkhead-like 13
  • Forkhead-related protein FKHL13
  • FoxJ1
  • Hepatocyte nuclear factor 3 forkhead homolog 4
  • HFH-4
  • HFH4fork head homologue 4
  • HFH-4forkhead box protein J1
  • MGC35202

Background

FOXJ1 is a member of the forkhead gene family, which was originally identified in Drosophila. The forkhead family is composed of transcription factors with a conserved 100-amino acid DNA-binding motif.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...


Uteroglobin/SCGB1A1 An ...
MAB4218
Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]
Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]
(1 Review)
(28 Publications)
Species: Hu
Applications: IHC, WB
FOXI1 Antibody
NBP2-16518
Immunohistochemistry-Paraffin FOXI1 Antibody
Western Blot FOXI1 Antibody
Western Blot FOXI1 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
HNF-3 beta/FoxA2
Antibody [Unconjugate ...
AF2400
Chromatin Immunoprecipitation (ChIP) HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunocytochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunohistochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
(98 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, WB
Prosurfactant
Protein C Antibody
NBP1-87201
Western Blot Prosurfactant Protein C Antibody
Immunohistochemistry-Paraffin Prosurfactant Protein C Antibody
Immunohistochemistry-Paraffin Prosurfactant Protein C Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
HNF-3 alpha/FoxA1
Antibody (3B11NB) - B ...
NBP2-45269
Flow Cytometry HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
Western Blot HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
Flow Cytometry HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
FoxM1 Antibody
AF3975
Western Blot FoxM1 Antibody
Immunocytochemistry FoxM1 Antibody
Western Blot FoxM1 Antibody
(2 Publications)
Species: Hu
Applications: ICC, WB
TTF-1 / NKX2-1
Antibody (8G7G3/1 + N ...
NBP2-44501
Immunohistochemistry TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
MLX Antibody
[Unconjugated]
AF4186
Western Blot MLX Antibody [Unconjugated]
Immunocytochemistry MLX Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ICC, WB
Sonic Hedgehog/Shh
[Unconjugated]
464-SH
Bioactivity Sonic Hedgehog/Shh [Unconjugated]
SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]
SEC-MALS Sonic Hedgehog/Shh [Unconjugated]
(69 Publications)
Species: Mu
Applications: BA
FOXO3 Antibody
NBP2-16521
Western Blot FOXO3 Antibody
Western Blot FOXO3 Antibody
Immunocytochemistry/ Immunofluorescence FOXO3 Antibody
(4 Reviews)
(12 Publications)
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
FOXQ1 Antibody
(OTI4D9) - Azide and ...
NBP2-72338
Flow Cytometry FOXQ1 Antibody (OTI4D9) - Azide and BSA Free
Immunohistochemistry FOXQ1 Antibody (OTI4D9) - Azide and BSA Free
Immunohistochemistry FOXQ1 Antibody (OTI4D9) - Azide and BSA Free
Species: Hu
Applications: Flow, IHC, IHC-P, WB
IL-13 [Biotin]
DY413
N/A IL-13 [Biotin]
(149 Publications)
Species: Mu
Applications: ELISA
PITX2 Antibody
[Unconjugated]
AF7388
Immunohistochemistry PITX2 Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
BMP-4
[Unconjugated]
314-BP
SDS-PAGE BMP-4 [Unconjugated]
Bioactivity BMP-4 [Unconjugated]
(522 Publications)
Species: Hu
Applications: BA, BA
Recombinant Human
SP-B/Surfactant Prote ...
H00006439-P01
Unknown Recombinant Human SP-B/Surfactant Protein B GST (N-Term) Protein
(2 Publications)
Species: Hu
Applications: ELISA, AP, PA, WB
FOXA3 Antibody
NBP2-87461
Immunohistochemistry FOXA3 Antibody
Western Blot FOXA3 Antibody
Western Blot FOXA3 Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
RNA polymerase I
termination factor An ...
NBP3-27122
Immunohistochemistry RNA polymerase I termination factor Antibody (2F4D8)
Western Blot RNA polymerase I termination factor Antibody (2F4D8)
ELISA RNA polymerase I termination factor Antibody (2F4D8)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
FGF
basic/FGF2/bFGF [Unco
233-FB
FGF basic/FGF2/bFGF [Unconjugated]
(555 Publications)
Species: Hu
Applications: BA
Recombinant Human
FoxJ1/HFH4 GST (N-Ter ...
H00002302-P01
Recombinant Human FoxJ1/HFH4 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for FoxJ1/HFH4 Recombinant Protein (H00002302-P01) (0)

There are no publications for FoxJ1/HFH4 Recombinant Protein (H00002302-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxJ1/HFH4 Recombinant Protein (H00002302-P01) (0)

There are no reviews for FoxJ1/HFH4 Recombinant Protein (H00002302-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FoxJ1/HFH4 Recombinant Protein (H00002302-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FoxJ1/HFH4 Products

Research Areas for FoxJ1/HFH4 Recombinant Protein (H00002302-P01)

Find related products by research area.

Blogs on FoxJ1/HFH4

There are no specific blogs for FoxJ1/HFH4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FoxJ1/HFH4 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol FOXJ1