Home » FoxJ1/HFH4 » FoxJ1 Peptides and Proteins » FoxJ1/HFH4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

FoxJ1/HFH4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for FoxJ1/HFH4 Recombinant Protein Antigen (NBP2-59032PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

FoxJ1/HFH4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FOXJ1.

Source: E. coli

Amino Acid Sequence: PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FOXJ1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-59032.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FoxJ1/HFH4 Recombinant Protein Antigen

  • FKHL13
  • FKHL13forkhead transcription factor HFH-4
  • forkhead box J1
  • forkhead-like 13
  • Forkhead-related protein FKHL13
  • FoxJ1
  • Hepatocyte nuclear factor 3 forkhead homolog 4
  • HFH-4
  • HFH4fork head homologue 4
  • HFH-4forkhead box protein J1
  • MGC35202

Background

FOXJ1 is a member of the forkhead gene family, which was originally identified in Drosophila. The forkhead family is composed of transcription factors with a conserved 100-amino acid DNA-binding motif.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...


Uteroglobin/SCGB1A1 An ...
MAB4218
Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]
Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]
(1 Review)
(28 Publications)
Species: Hu
Applications: IHC, WB
FOXI1 Antibody
NBP2-16518
Immunohistochemistry-Paraffin FOXI1 Antibody
Western Blot FOXI1 Antibody
Western Blot FOXI1 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
HNF-3 beta/FoxA2
Antibody [Unconjugate ...
AF2400
Chromatin Immunoprecipitation (ChIP) HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunocytochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunohistochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
(99 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, WB
Prosurfactant
Protein C Antibody
NBP1-87201
Western Blot Prosurfactant Protein C Antibody
Immunohistochemistry-Paraffin Prosurfactant Protein C Antibody
Immunohistochemistry-Paraffin Prosurfactant Protein C Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
HNF-3 alpha/FoxA1
Antibody (3B11NB) - B ...
NBP2-45269
Flow Cytometry HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
Western Blot HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
Flow Cytometry HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
FoxM1 Antibody
AF3975
Western Blot FoxM1 Antibody
Immunocytochemistry FoxM1 Antibody
Western Blot FoxM1 Antibody
(2 Publications)
Species: Hu
Applications: ICC, WB
TTF-1 / NKX2-1
Antibody (8G7G3/1 + N ...
NBP2-44501
Immunohistochemistry TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
MLX Antibody
[Unconjugated]
AF4186
Western Blot MLX Antibody [Unconjugated]
Immunocytochemistry MLX Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ICC, WB
Sonic Hedgehog/Shh
[Unconjugated]
464-SH
Bioactivity Sonic Hedgehog/Shh [Unconjugated]
SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]
SEC-MALS Sonic Hedgehog/Shh [Unconjugated]
(69 Publications)
Species: Mu
Applications: BA
FOXO3 Antibody
NBP2-16521
Western Blot FOXO3 Antibody
Western Blot FOXO3 Antibody
Immunocytochemistry/ Immunofluorescence FOXO3 Antibody
(4 Reviews)
(12 Publications)
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
FOXQ1 Antibody
(OTI4D9) - Azide and ...
NBP2-72338
Flow Cytometry FOXQ1 Antibody (OTI4D9) - Azide and BSA Free
Immunohistochemistry FOXQ1 Antibody (OTI4D9) - Azide and BSA Free
Immunohistochemistry FOXQ1 Antibody (OTI4D9) - Azide and BSA Free
Species: Hu
Applications: Flow, IHC, IHC-P, WB
IL-13 [Biotin]
DY413
N/A IL-13 [Biotin]
(149 Publications)
Species: Mu
Applications: ELISA
PITX2 Antibody
[Unconjugated]
AF7388
Immunohistochemistry PITX2 Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
BMP-4
[Unconjugated]
314-BP
SDS-PAGE BMP-4 [Unconjugated]
Bioactivity BMP-4 [Unconjugated]
(525 Publications)
Species: Hu
Applications: BA, BA
Recombinant Human
SP-B/Surfactant Prote ...
H00006439-P01
Unknown Recombinant Human SP-B/Surfactant Protein B GST (N-Term) Protein
(2 Publications)
Species: Hu
Applications: ELISA, AP, PA, WB
FOXA3 Antibody
NBP2-87461
Immunohistochemistry FOXA3 Antibody
Western Blot FOXA3 Antibody
Western Blot FOXA3 Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
RNA polymerase I
termination factor An ...
NBP3-27122
Immunohistochemistry RNA polymerase I termination factor Antibody (2F4D8)
Western Blot RNA polymerase I termination factor Antibody (2F4D8)
ELISA RNA polymerase I termination factor Antibody (2F4D8)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
FGF
basic/FGF2/bFGF [Unco
233-FB
FGF basic/FGF2/bFGF [Unconjugated]
(555 Publications)
Species: Hu
Applications: BA
FoxJ1/HFH4
Recombinant Protein A
NBP2-59032PEP
FoxJ1/HFH4 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for FoxJ1/HFH4 Recombinant Protein Antigen (NBP2-59032PEP) (0)

There are no publications for FoxJ1/HFH4 Recombinant Protein Antigen (NBP2-59032PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxJ1/HFH4 Recombinant Protein Antigen (NBP2-59032PEP) (0)

There are no reviews for FoxJ1/HFH4 Recombinant Protein Antigen (NBP2-59032PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FoxJ1/HFH4 Recombinant Protein Antigen (NBP2-59032PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FoxJ1/HFH4 Products

Research Areas for FoxJ1/HFH4 Recombinant Protein Antigen (NBP2-59032PEP)

Find related products by research area.

Blogs on FoxJ1/HFH4

There are no specific blogs for FoxJ1/HFH4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FoxJ1/HFH4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FOXJ1