FoxH1 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FoxH1 (NP_003914). Peptide sequence MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAP |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FOXH1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
39 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for FoxH1 Antibody
Background
Fas, also referred to as CD95 or APO-1, is a type I transmembrane protein that plays a central role mediating viral immunity. TIA-1 and TIAR are two closely related proteins that possess three RRMs (RNA recognition motifs), designated RRM 1, 2 and 3, respectively. Although both TIA-1 and TIAR are thought to function as mediators of apoptotic cell death, their specific roles in such pathways are unknown. Unlike TIA-1, which is found in the granules of cytotoxic lymphocytes, TIAR expression is limited to the nucleus and found in a much broader range of cells including, but not limited to, cells of hematopoietic origin. TIAR is translocated to the cytoplasm shortly after Fas ligation and this event immediately proceeds the onset of DNA fragmentation. A novel serine/ threonine kinase that is activated as a result of Fas ligation, designated FAST (Fas-activated serine/threonine), shows kinase specificity towards both TIA-1 and TIAR. In unstimulated Jurkat cells, FAST resides in the cytoplasm as a highly phosphorylated protein and is quickly dephosphorylated and activated in response to stimulated Fas.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ChIP, ICC, WB
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Mu
Applications: Block, ICC, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for FoxH1 Antibody (NBP3-10476) (0)
There are no publications for FoxH1 Antibody (NBP3-10476).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FoxH1 Antibody (NBP3-10476) (0)
There are no reviews for FoxH1 Antibody (NBP3-10476).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FoxH1 Antibody (NBP3-10476) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FoxH1 Products
Research Areas for FoxH1 Antibody (NBP3-10476)
Find related products by research area.
|
Blogs on FoxH1