![Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Analysis in human bone marrow and pancreas tissues using NBP1-84706 antibody. Corresponding Ficolin-1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Ficolin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-84706-img0012.jpg "Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Analysis in human bone marrow and pancreas tissues using NBP1-84706 antibody. Corresponding Ficolin-1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FCN1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FCN1 |
![Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Staining of human bone marrow, gastrointestinal, lymphoid tissues and pancreas using Anti-Ficolin-1 antibody NBP1-84706 (A) shows similar protein distribution across tissues to independent antibody NBP1-84705 (B).](http://images.novusbio.com/fullsize/Ficolin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-84706-img0011.jpg "Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Staining of human bone marrow, gastrointestinal, lymphoid tissues and pancreas using Anti-Ficolin-1 antibody NBP1-84706 (A) shows similar protein distribution across tissues to independent antibody NBP1-84705 (B).")
![Western Blot: Ficolin-1 Antibody [NBP1-84706] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human cell line A-431 Lane 5: Human liver tissue](http://images.novusbio.com/fullsize/Ficolin-1-Antibody-Western-Blot-NBP1-84706-img0004.jpg "Western Blot: Ficolin-1 Antibody [NBP1-84706] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human cell line A-431 Lane 5: Human liver tissue")
![Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.](http://images.novusbio.com/fullsize/Ficolin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-84706-img0007.jpg "Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.")
![Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/Ficolin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-84706-img0008.jpg "Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/Ficolin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-84706-img0009.jpg "Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Ficolin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-84706-img0010.jpg "Immunohistochemistry-Paraffin: Ficolin-1 Antibody [NBP1-84706] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![N/A Pentraxin 3/TSG-14 [Biotin]](https://images.novusbio.com/images2/DATA_Pentraxin_3_DY1826_ELISA_1725.jpg)
![Western Blot Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Western_Blot_5334.jpg)
![Immunohistochemistry Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Immunohistochemistry_10404.jpg)
![Simple Western Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Simple_Western_16649.jpg)
![Western Blot Pentraxin 2/SAP Antibody [Unconjugated]](https://images.novusbio.com/images2/Pentraxin_2_AF2558_Western_Blot_15557.jpg)
![Simple Western Pentraxin 2/SAP Antibody [Unconjugated]](https://images.novusbio.com/images2/Pentraxin_2_AF2558_Simple_Western_17977.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")