![Western Blot: FECH Antibody [NBP2-33413] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://images.novusbio.com/fullsize/FECH-Antibody-Western-Blot-NBP2-33413-img0004.jpg "Western Blot: FECH Antibody [NBP2-33413] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQ |
| Predicted Species | Mouse (91%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FECH |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Publication using NBP2-33413 | Applications | Species |
|---|---|---|
| He G, Li Y, Younis MR et al. Synthetic biology-instructed transdermal microneedle patch for traceable photodynamic therapy Nature communications 2022-10-20 [PMID: 36266306] (WB, Human) Details: Dilution used in WB 1:1000 |
WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for FECH Antibody (NBP2-33413)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: FECH Antibody [NBP2-33413] - Staining of human lymph node shows no positivity in germinal center cells as expected.](http://images.novusbio.com/fullsize/FECH-Antibody-Immunohistochemistry-Paraffin-NBP2-33413-img0007.jpg "Immunohistochemistry-Paraffin: FECH Antibody [NBP2-33413] - Staining of human lymph node shows no positivity in germinal center cells as expected.")
![Immunohistochemistry-Paraffin: FECH Antibody [NBP2-33413] - Staining of human kidney shows strong granular positivity in cells in tubules.](http://images.novusbio.com/fullsize/FECH-Antibody-Immunohistochemistry-Paraffin-NBP2-33413-img0001.jpg "Immunohistochemistry-Paraffin: FECH Antibody [NBP2-33413] - Staining of human kidney shows strong granular positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: FECH Antibody [NBP2-33413] - Staining of human liver shows weak granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/FECH-Antibody-Immunohistochemistry-Paraffin-NBP2-33413-img0005.jpg "Immunohistochemistry-Paraffin: FECH Antibody [NBP2-33413] - Staining of human liver shows weak granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: FECH Antibody [NBP2-33413] - Staining of human prostate shows moderate granular cytoplasmicd positivity in glandular cells.](http://images.novusbio.com/fullsize/FECH-Antibody-Immunohistochemistry-Paraffin-NBP2-33413-img0006.jpg "Immunohistochemistry-Paraffin: FECH Antibody [NBP2-33413] - Staining of human prostate shows moderate granular cytoplasmicd positivity in glandular cells.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Immunohistochemistry Orexin A/Hypocretin-1 Antibody (97505) [Unconjugated]](https://images.novusbio.com/images2/mab763_human-mouse-rat-orexin-a-hypocretin-1-mab-clone-97505-immunohistochemistry-30112022115129.jpg)
![Western Blot Dopa Decarboxylase/DDC Antibody [Unconjugated]](https://images.novusbio.com/images2/Dopa_Decarboxylase_AF3564_Western_Blot_17092.jpg)
![Immunohistochemistry Dopa Decarboxylase/DDC Antibody [Unconjugated]](https://images.novusbio.com/images2/Dopa_Decarboxylase_AF3564_Immunohistochemistry_19241.jpg)
![Immunohistochemistry Dopa Decarboxylase/DDC Antibody [Unconjugated]](https://images.novusbio.com/images2/Dopa_Decarboxylase_AF3564_Immunohistochemistry_19242.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")